DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and Ppp3r2

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001004025.1 Gene:Ppp3r2 / 19059 MGIID:107171 Length:179 Species:Mus musculus


Alignment Length:181 Identity:45/181 - (24%)
Similarity:76/181 - (41%) Gaps:38/181 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NYVYMKDIARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLSALMELLFEIVDRDLIA 81
            |:...::|.||.|.              :.|..|   .::..::|::...|.||    ....|:.
Mouse    13 NHFDQEEIRRLGKS--------------FRKLDL---DKSGSLSIEEFMRLPEL----QQNPLVG 56

  Fly    82 TIVYRIAHTPGSRPPDFFSDKHIHLESFVRLFTVYFTK-DLQLKMEFAFSVYD-KSDSKQLNGEQ 144
            .:: .|..|.|:...||        ..|:...:.:..| |.:.|:.|||.:|| .:|....|||.
Mouse    57 RVI-DIFDTDGNGEVDF--------HEFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGEL 112

  Fly   145 VGFFVGKFFESED-EDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVR 194
              |.|.|.....: :|..::..:| |.:|.|  |.|.|..|..:|:.:||:
Mouse   113 --FQVLKMMVGNNLKDWQLQQLVD-KSILVL--DKDGDGRISFEEFSDVVK 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
Ppp3r2NP_001004025.1 PTZ00184 17..153 CDD:185504 41/170 (24%)
EFh 25..76 CDD:238008 13/80 (16%)
EFh 91..158 CDD:238008 24/71 (34%)
Calcineurin A binding. /evidence=ECO:0000250|UniProtKB:Q63810 131..136 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.