DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and chpf-1

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_001379127.1 Gene:chpf-1 / 179415 WormBaseID:WBGene00014109 Length:195 Species:Caenorhabditis elegans


Alignment Length:190 Identity:36/190 - (18%)
Similarity:78/190 - (41%) Gaps:35/190 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KDIARLAKDSIFSHNELISIVMLYHKFVLVNGPRAKYMTIQQLSALMELLFEIVDRDLIATIVYR 86
            ::|..:..::.|:.|:   ||.||.:|:.::.....:::......:.||....:. |.|....:.
 Worm    12 EEIEEIMSETEFNRNQ---IVRLYSRFLSLDKKGQGFLSRDDFLNVPELAVNPLG-DRIVDAFFT 72

  Fly    87 IAHTPGSRPPDFFSDKHIHLESFVRLFTVY------------FTKDLQLKMEFAFSVYDKSDSKQ 139
            :|.:.|..     .::.::...|||:...:            ..||   |:.|||.:||.:.:..
 Worm    73 LASSNGDN-----EEQQLNFRQFVRILAHFQPISRVKKNALNSRKD---KLLFAFKMYDLNKNDY 129

  Fly   140 LNGEQ----VGFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRR 195
            :..|:    :...||....|:..|:..:..::       :.|.|:|..|..||:...:.:
 Worm   130 ITREEFKVILNSMVGANITSDQLDKIADRTIE-------EADADRDGKISFDEFCRAMEK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
chpf-1NP_001379127.1 FRQ1 14..182 CDD:227455 36/186 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.