DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and Guca1a

DIOPT Version :9

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_032215.2 Gene:Guca1a / 14913 MGIID:102770 Length:202 Species:Mus musculus


Alignment Length:109 Identity:21/109 - (19%)
Similarity:50/109 - (45%) Gaps:0/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DFFSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGEQVGFFVGKFFESEDEDES 161
            ||..|.:|....:|...::.....::.|:.:.|.:||...:..::.:::...:..........:|
Mouse    64 DFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAIRTINPWSDS 128

  Fly   162 IELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPMLLECFGR 205
            .....:..:.:|.|.|::.|..:.::|:.|.|::..|||:...|
Mouse   129 SMSAEEFTDTVFAKIDINGDGELSLEEFMEGVQKDQMLLDTLTR 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
Guca1aNP_032215.2 FRQ1 12..163 CDD:227455 17/98 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.