DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3565 and CHP1

DIOPT Version :10

Sequence 1:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster
Sequence 2:NP_009167.1 Gene:CHP1 / 11261 HGNCID:17433 Length:195 Species:Homo sapiens


Alignment Length:181 Identity:39/181 - (21%)
Similarity:67/181 - (37%) Gaps:60/181 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KDIARLAKDSIFSHNELISIVMLYHKFVLV----NG--PRAKYMTIQQLSALMELLFEIVDRDLI 80
            :::..:.|::.|||::   |..||.:|..:    ||  .|..:..|.:|:     :..:.||.:.
Human    12 EELEEIKKETGFSHSQ---ITRLYSRFTSLDKGENGTLSREDFQRIPELA-----INPLGDRIIN 68

  Fly    81 ATIVYRIAHTPGSRPPDFF--SDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYDKSDSKQLNGE 143
            |                ||  .:..::...|:|.. .:|.           .:.|...||.:|| 
Human    69 A----------------FFPEGEDQVNFRGFMRTL-AHFR-----------PIEDNEKSKDVNG- 104

  Fly   144 QVGFFVGKFFESEDEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVR 194
                           .|.:..|.:.....|..:|||||..|..||..:|:|
Human   105 ---------------PEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3565NP_611942.1 None
CHP1NP_009167.1 Necessary for association with microtubule and interaction with GAPDH. /evidence=ECO:0000250 2..6
FRQ1 27..182 CDD:444056 35/166 (21%)
Nuclear export signal 1. /evidence=ECO:0000250 138..147 2/3 (67%)
Necessary for nuclear export signal 143..185
Nuclear export signal 2. /evidence=ECO:0000250 176..185
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.