DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynF and ATP5MF

DIOPT Version :9

Sequence 1:NP_611940.1 Gene:ATPsynF / 37931 FlyBaseID:FBgn0035032 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_004880.1 Gene:ATP5MF / 9551 HGNCID:848 Length:94 Species:Homo sapiens


Alignment Length:75 Identity:26/75 - (34%)
Similarity:44/75 - (58%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QVKLGEIGAWLGRRNKTPNAVAGAVSRAWWRWQHKYVFPKRAGIAPFFQLTVASMTFFYLINYTK 97
            :|||||:.:|:..|:.:|:.:.||..|.::|:.:||:..|:..|:....:....:.|.|..:|..
Human    20 EVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKH 84

  Fly    98 LKHHRNYKYH 107
            |||.|..|||
Human    85 LKHERLRKYH 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynFNP_611940.1 WRW 2..103 CDD:402005 22/69 (32%)
ATP5MFNP_004880.1 WRW <14..89 CDD:313438 22/68 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143577
Domainoid 1 1.000 53 1.000 Domainoid score I11416
eggNOG 1 0.900 - - E1_KOG4092
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1479342at2759
OrthoFinder 1 1.000 - - FOG0005095
OrthoInspector 1 1.000 - - oto89169
orthoMCL 1 0.900 - - OOG6_109232
Panther 1 1.100 - - LDO PTHR13080
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4479
SonicParanoid 1 1.000 - - X6317
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.