DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynF and Atp5j2

DIOPT Version :9

Sequence 1:NP_611940.1 Gene:ATPsynF / 37931 FlyBaseID:FBgn0035032 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_065607.1 Gene:Atp5j2 / 57423 MGIID:1927558 Length:88 Species:Mus musculus


Alignment Length:75 Identity:29/75 - (38%)
Similarity:47/75 - (62%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QVKLGEIGAWLGRRNKTPNAVAGAVSRAWWRWQHKYVFPKRAGIAPFFQLTVASMTFFYLINYTK 97
            :|||||:.:|:..|:.||:.:|||..|.:.|:.:||:..::..|:....:..|.:.|.|.|:|.:
Mouse    14 EVKLGELPSWIMMRDFTPSGIAGAFRRGYDRYYNKYINVRKGSISGISMVLAAYVVFSYCISYKE 78

  Fly    98 LKHHRNYKYH 107
            |||.|..|||
Mouse    79 LKHERRRKYH 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynFNP_611940.1 WRW 2..103 CDD:402005 25/69 (36%)
Atp5j2NP_065607.1 WRW <8..84 CDD:313438 25/69 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833732
Domainoid 1 1.000 58 1.000 Domainoid score I10788
eggNOG 1 0.900 - - E1_KOG4092
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 65 1.000 Inparanoid score I5361
Isobase 1 0.950 - 0 Normalized mean entropy S5298
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005095
OrthoInspector 1 1.000 - - oto92733
orthoMCL 1 0.900 - - OOG6_109232
Panther 1 1.100 - - LDO PTHR13080
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6317
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.700

Return to query results.
Submit another query.