DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynF and atp5mf

DIOPT Version :9

Sequence 1:NP_611940.1 Gene:ATPsynF / 37931 FlyBaseID:FBgn0035032 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_001290058.1 Gene:atp5mf / 402883 ZFINID:ZDB-GENE-050309-87 Length:89 Species:Danio rerio


Alignment Length:74 Identity:28/74 - (37%)
Similarity:39/74 - (52%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VKLGEIGAWLGRRNKTPNAVAGAVSRAWWRWQHKYVFPKRAGIAPFFQLTVASMTFFYLINYTKL 98
            ||||::.||||.|:.|||.|...:...:.|:.:||:..|:.||.......|..:...|...|..:
Zfish    16 VKLGQLPAWLGTRDFTPNGVVRGIRGGYERYYNKYINVKKGGIGGIAMFLVGYVVLSYAWEYDHI 80

  Fly    99 KHHRNYKYH 107
            ||.|..|||
Zfish    81 KHDRWRKYH 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynFNP_611940.1 WRW 2..103 CDD:402005 24/68 (35%)
atp5mfNP_001290058.1 WRW <9..84 CDD:287211 24/67 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576456
Domainoid 1 1.000 52 1.000 Domainoid score I11474
eggNOG 1 0.900 - - E1_KOG4092
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5425
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1479342at2759
OrthoFinder 1 1.000 - - FOG0005095
OrthoInspector 1 1.000 - - otm25772
orthoMCL 1 0.900 - - OOG6_109232
Panther 1 1.100 - - LDO PTHR13080
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6317
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.