DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynF and R53.4

DIOPT Version :9

Sequence 1:NP_611940.1 Gene:ATPsynF / 37931 FlyBaseID:FBgn0035032 Length:107 Species:Drosophila melanogaster
Sequence 2:NP_496152.1 Gene:R53.4 / 174554 WormBaseID:WBGene00011273 Length:153 Species:Caenorhabditis elegans


Alignment Length:103 Identity:38/103 - (36%)
Similarity:51/103 - (49%) Gaps:11/103 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GDYPAEYNPKVHGPYDPARFYGKADVPFGQVKLGEIGAWLGRRNKTPNAVAGAVSRAWWRWQHKY 68
            |.:...:|..|||||...|:|||.|..|..||||::.||:.||.|||:|......|..||..:.|
 Worm    47 GLFDKRWNKNVHGPYCHWRYYGKLDTKFMDVKLGDLPAWMARREKTPSAFYNEFMRNIWRVHNLY 111

  Fly    69 VFPKRAGIAPFFQLTVASMTFFYLINYTKL----KHHR 102
            .      ..|.:..|| .:.|.::..|:.|    |.||
 Worm   112 Y------SGPVYNNTV-KVIFRFIFAYSFLNWLVKSHR 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynFNP_611940.1 WRW 2..103 CDD:402005 38/103 (37%)
R53.4NP_496152.1 WRW 45..148 CDD:287211 38/103 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158937
Domainoid 1 1.000 62 1.000 Domainoid score I6899
eggNOG 1 0.900 - - E1_KOG4092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5298
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1479342at2759
OrthoFinder 1 1.000 - - FOG0005095
OrthoInspector 1 1.000 - - oto19595
orthoMCL 1 0.900 - - OOG6_109232
Panther 1 1.100 - - LDO PTHR13080
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4479
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.