DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynF and c17orf80

DIOPT Version :9

Sequence 1:NP_611940.1 Gene:ATPsynF / 37931 FlyBaseID:FBgn0035032 Length:107 Species:Drosophila melanogaster
Sequence 2:XP_031750501.1 Gene:c17orf80 / 100380129 XenbaseID:XB-GENE-5886446 Length:497 Species:Xenopus tropicalis


Alignment Length:125 Identity:29/125 - (23%)
Similarity:48/125 - (38%) Gaps:27/125 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 EYNPKVHGPYDPARF------YGK-------ADVPFG-------------QVKLGEIGAWLGRRN 47
            ::.|:::..|...||      :|.       .|.|.|             .|::.|...|:. .:
 Frog   374 QWFPELYPNYISLRFILGRQSHGNIEWNTNTIDAPKGADHDTPLALRNVMDVRMREFPLWIA-NH 437

  Fly    48 KTPNAVAGAVSRAWWRWQHKYVFPKRAGIAPFFQLTVASMTFFYLINYTKLKHHRNYKYH 107
            .:...:.|||.:||.::..||:..|:.||.....|........|..||..:|..|..:||
 Frog   438 FSIRTLPGAVQKAWGQYYSKYINVKKGGIGGLTMLLAGYCILSYTWNYDHIKQDRWRRYH 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynFNP_611940.1 WRW 2..103 CDD:402005 26/119 (22%)
c17orf80XP_031750501.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005095
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13080
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.