DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynF and si:dkey-21c1.4

DIOPT Version :9

Sequence 1:NP_611940.1 Gene:ATPsynF / 37931 FlyBaseID:FBgn0035032 Length:107 Species:Drosophila melanogaster
Sequence 2:XP_021336062.1 Gene:si:dkey-21c1.4 / 100151186 ZFINID:ZDB-GENE-130603-44 Length:477 Species:Danio rerio


Alignment Length:78 Identity:27/78 - (34%)
Similarity:37/78 - (47%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 FGQVKLGEIGAWLGRRNK-TPNAVAGAVSRAWWRWQHKYVFPKRAGIAPFFQLTVASMTFFYLIN 94
            ||.|:|.|:|.|||.|.. :|..:.....:.|..:..||:..:|.|:.....|........|:.|
Zfish   400 FGDVRLNELGLWLGARAPVSPGEIVNMFKQGWQWYYRKYIDVRRGGVGGISMLLTGYCVLCYIWN 464

  Fly    95 YTKLKHHRNYKYH 107
            ||.||..|..|||
Zfish   465 YTHLKKDRWRKYH 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynFNP_611940.1 WRW 2..103 CDD:402005 23/72 (32%)
si:dkey-21c1.4XP_021336062.1 WRW <399..472 CDD:313438 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576455
Domainoid 1 1.000 52 1.000 Domainoid score I11474
eggNOG 1 0.900 - - E1_KOG4092
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005095
OrthoInspector 1 1.000 - - otm25772
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13080
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4479
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.