DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13587 and REG1A

DIOPT Version :9

Sequence 1:NP_611939.1 Gene:CG13587 / 37930 FlyBaseID:FBgn0035031 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_002900.2 Gene:REG1A / 5967 HGNCID:9951 Length:166 Species:Homo sapiens


Alignment Length:127 Identity:27/127 - (21%)
Similarity:52/127 - (40%) Gaps:23/127 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 YLNASLTCSNSSEFTGSLAHIASEHRTSLLAQWLVEFNRKSQSLAEGNVYLAYVGLAYNSSTSLS 233
            :::|.|.|.|.:  :|:|..:.::...:.:|..:     |.....:.||   ::||.       .
Human    57 WVDADLYCQNMN--SGNLVSVLTQAEGAFVASLI-----KESGTDDFNV---WIGLH-------D 104

  Fly   234 PLDFRNSQGESLQCFLYRAWDGGHPRVGGDLGNASCVALTPQ---GTWQTLNCDRELPFICE 292
            |...|.....|.....|::|..|.|   ..:....||:||..   ..|:.:.|:.:..|:|:
Human   105 PKKNRRWHWSSGSLVSYKSWGIGAP---SSVNPGYCVSLTSSTGFQKWKDVPCEDKFSFVCK 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13587NP_611939.1 CLECT 160..293 CDD:153057 27/127 (21%)
REG1ANP_002900.2 CLECT 36..164 CDD:321932 27/127 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.