DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13587 and si:dkey-241l7.5

DIOPT Version :9

Sequence 1:NP_611939.1 Gene:CG13587 / 37930 FlyBaseID:FBgn0035031 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001231960.1 Gene:si:dkey-241l7.5 / 565442 ZFINID:ZDB-GENE-041014-237 Length:153 Species:Danio rerio


Alignment Length:132 Identity:28/132 - (21%)
Similarity:40/132 - (30%) Gaps:35/132 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 ASEHRTSLLAQW----------------LVEFNRKSQSLAEGNVYLAYVGLAYNSSTSLSPLDFR 238
            |.|.|.|....|                .|...|..|||. ||:...:..:..:...||.|...|
Zfish    20 ADEERLSCERGWSRSGSRCFRFFSRSVNWVTAERNCQSLG-GNLASVHDQVENDFLLSLVPGSTR 83

  Fly   239 --------NSQGESL----QCFLYRAWDGGHPRVGGDLGNASCVAL--TPQGTWQTLNCDRELPF 289
                    ...|:.|    ..:.|..|..|.|..|.:    .|:.:  |....|....|...:.:
Zfish    84 CWIGGHDGEQDGQWLWSDGSVYGYTNWCSGEPSSGSE----HCLEINWTSNHCWNNQGCSTRMGY 144

  Fly   290 IC 291
            :|
Zfish   145 LC 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13587NP_611939.1 CLECT 160..293 CDD:153057 28/132 (21%)
si:dkey-241l7.5NP_001231960.1 CLECT 27..146 CDD:214480 23/123 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422658at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.