Sequence 1: | NP_611939.1 | Gene: | CG13587 / 37930 | FlyBaseID: | FBgn0035031 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026840.1 | Gene: | si:ch211-282j17.10 / 557030 | ZFINID: | ZDB-GENE-041210-283 | Length: | 368 | Species: | Danio rerio |
Alignment Length: | 212 | Identity: | 42/212 - (19%) |
---|---|---|---|
Similarity: | 83/212 - (39%) | Gaps: | 50/212 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 125 NTFSGMVNDSRFDYYSLYGRP-----------------TVVRNYSCIPE----VGLFVVY--TQP 166
Fly 167 SAYLNASLTCSNSSEFTG----SLAHIASEHRTSLLAQWLVEFNRKSQSLAEGNVYLAYVGLAYN 227
Fly 228 SSTSLSPLDFRNSQGESLQCFLYRAWDGGHPRVGGDLGNASCVALTPQGTWQTLNCD-RELPFIC 291
Fly 292 ---EIHTARSTFGWEQS 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13587 | NP_611939.1 | CLECT | 160..293 | CDD:153057 | 31/142 (22%) |
si:ch211-282j17.10 | NP_001026840.1 | CLECT | 24..131 | CDD:295302 | 12/59 (20%) |
CLECT_1 | 134..247 | CDD:153072 | 27/131 (21%) | ||
CLECT | 253..365 | CDD:153057 | 1/11 (9%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D422658at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |