DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13587 and si:ch211-282j17.10

DIOPT Version :9

Sequence 1:NP_611939.1 Gene:CG13587 / 37930 FlyBaseID:FBgn0035031 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001026840.1 Gene:si:ch211-282j17.10 / 557030 ZFINID:ZDB-GENE-041210-283 Length:368 Species:Danio rerio


Alignment Length:212 Identity:42/212 - (19%)
Similarity:83/212 - (39%) Gaps:50/212 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 NTFSGMVNDSRFDYYSLYGRP-----------------TVVRNYSCIPE----VGLFVVY--TQP 166
            |.:.|:...|.:.::...|.|                 ||:.|...|.|    ..:||.|  ::.
Zfish    71 NIWIGLQRTSVYKWHWSSGDPVFFLNWTSEEPAGNNECTVMNNGQWINEACNNTRVFVCYNMSRG 135

  Fly   167 SAYLNASLTCSNSSEFTG----SLAHIASEHRTSLLAQWLVEFNRKSQSLAEGNVYLAYVGLAYN 227
            ..::|..:|..::..:..    .|..:.:::....|.:::.:.|....::        ::|| :.
Zfish   136 LVFVNQMMTWRDAQSYCRQNHIDLVSVRNQNENQQLEKFINDRNSSGSAV--------WIGL-FR 191

  Fly   228 SSTSLSPLDFRNSQGESLQCFLYRAWDGGHPRVGGDLGNASCVALTPQGTWQTLNCD-RELPFIC 291
            .|...|  |..||.        :|.||.|.|..||:..|.:.:....|..|..:.|| |::||:|
Zfish   192 DSWQWS--DQSNSS--------FRYWDTGEPNNGGEYDNCTVIGANAQRGWADVPCDNRQIPFVC 246

  Fly   292 ---EIHTARSTFGWEQS 305
               ::...:....|.::
Zfish   247 HEDKLIVIQQNLSWSEA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13587NP_611939.1 CLECT 160..293 CDD:153057 31/142 (22%)
si:ch211-282j17.10NP_001026840.1 CLECT 24..131 CDD:295302 12/59 (20%)
CLECT_1 134..247 CDD:153072 27/131 (21%)
CLECT 253..365 CDD:153057 1/11 (9%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422658at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.