Sequence 1: | NP_611939.1 | Gene: | CG13587 / 37930 | FlyBaseID: | FBgn0035031 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021333330.1 | Gene: | si:dkey-192d15.3 / 556893 | ZFINID: | ZDB-GENE-040724-245 | Length: | 363 | Species: | Danio rerio |
Alignment Length: | 215 | Identity: | 34/215 - (15%) |
---|---|---|---|
Similarity: | 76/215 - (35%) | Gaps: | 59/215 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 131 VNDSR----------FDYYSLYGRPTVVRNYSCIPEVGL---------------------FVVY- 163
Fly 164 -TQPSAYLNASLTCSNSSEFT----GSLAHIASEHRTSLLAQWLVEFNRKSQSLAEGNVYLAYVG 223
Fly 224 LAYNSSTSLSPLDFRNSQGESLQCFLYRAWDGGHPRVGGDLGNASCVALTPQGTWQTLNCDRELP 288
Fly 289 FIC---EIHTARSTFGWEQS 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13587 | NP_611939.1 | CLECT | 160..293 | CDD:153057 | 24/141 (17%) |
si:dkey-192d15.3 | XP_021333330.1 | CLECT | 23..128 | CDD:321932 | 10/63 (16%) |
CLECT | 131..243 | CDD:321932 | 21/130 (16%) | ||
CLECT | 249..361 | CDD:153057 | 1/11 (9%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D422658at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |