DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13587 and ASGR1

DIOPT Version :9

Sequence 1:NP_611939.1 Gene:CG13587 / 37930 FlyBaseID:FBgn0035031 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001662.1 Gene:ASGR1 / 432 HGNCID:742 Length:291 Species:Homo sapiens


Alignment Length:269 Identity:52/269 - (19%)
Similarity:81/269 - (30%) Gaps:94/269 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KLNPLQFHLVRQCQRAAADEALALENTSSLKECADLAHDMRGLALNYAPGGPKRRLNAFDQRSFG 91
            |:..|:..|.:|      .:.|:.:::|.|........|:|.|:...|                .
Human   101 KMKSLESQLEKQ------QKDLSEDHSSLLLHVKQFVSDLRSLSCQMA----------------A 143

  Fly    92 KQGDKEQRIRSRLSVFEQPGEFFNCHVLKCPQNNTFSGMVNDSRFDY-YSLYGRPTV-VRNYSCI 154
            .||:..:|               .|    ||.|     .|...|..| :|..|:... ..||..:
Human   144 LQGNGSER---------------TC----CPVN-----WVEHERSCYWFSRSGKAWADADNYCRL 184

  Fly   155 PEVGLFVVYTQPSAYLNASLTCSNSSEFTGSLAHIASEHRTSLLAQWLVEFNRKSQSLAEGNVYL 219
            .:..|.||            |.....:|.        :|....:..|:        .|.:.|...
Human   185 EDAHLVVV------------TSWEEQKFV--------QHHIGPVNTWM--------GLHDQNGPW 221

  Fly   220 AYV-GLAYNSSTSLSPLDFRNSQGESLQCFLYRAWDGGHPRVGGDLGNASCVALTPQGTWQTLNC 283
            .:| |..|.:.       |:|.:.|....:.      ||...||:    .|...|..|.|....|
Human   222 KWVDGTDYETG-------FKNWRPEQPDDWY------GHGLGGGE----DCAHFTDDGRWNDDVC 269

  Fly   284 DRELPFICE 292
            .|...::||
Human   270 QRPYRWVCE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13587NP_611939.1 CLECT 160..293 CDD:153057 26/134 (19%)
ASGR1NP_001662.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 17..144 CDD:309178 11/64 (17%)
CLECT_DC-SIGN_like 154..279 CDD:153060 37/175 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.