DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13587 and CLEC17A

DIOPT Version :9

Sequence 1:NP_611939.1 Gene:CG13587 / 37930 FlyBaseID:FBgn0035031 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001191047.1 Gene:CLEC17A / 388512 HGNCID:34520 Length:378 Species:Homo sapiens


Alignment Length:327 Identity:64/327 - (19%)
Similarity:101/327 - (30%) Gaps:119/327 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LMGVSRGSLNCPTGKL------NPLQFHLVRQ--------------CQRAAADEALALENTSSLK 57
            :.|:...::.||..:|      :|||..|...              ||:........|..||...
Human   119 MTGLDLAAVTCPPPQLAVNLEPSPLQPSLAATPVPWLNQRSGGPGCCQKRWMVYLCLLVVTSLFL 183

  Fly    58 ECADLAHDMRGLALNYAPGGPKRRLNAFDQRSF--------GKQGDKEQRIRSRLSVFEQPGEFF 114
            .|..|...:    :.|.....:.|:.:|.|.::        |..|.|....|.|....:...|.:
Human   184 GCLGLTVTL----IKYQELMEELRMLSFQQMTWRTNMTGMAGLAGLKHDIARVRADTNQSLVELW 244

  Fly   115 ---NCHVLKCPQN-NTFSGMVNDSRFDYYSLYGRPTVVRNYSCIPEVGLFVVYTQPS--AYLNAS 173
               :|..:.||:. ..|.|                      .|        .|..||  ::..|.
Human   245 GLLDCRRITCPEGWLPFEG----------------------KC--------YYFSPSTKSWDEAR 279

  Fly   174 LTCSNSSEFTGSLAHIASEHRTSLLAQWLVEFNRKSQSLAEGNVYLAYVGLAYNSSTSLSP---- 234
            :.|..      :.:|             ||..|    |.||.|    :|..|:.     ||    
Human   280 MFCQE------NYSH-------------LVIIN----SFAEHN----FVAKAHG-----SPRVYW 312

  Fly   235 --LDFRNSQGESLQCFLYRAWDGG-------HPRVGGDLGNASCVALTPQGTWQTLNCDRELPFI 290
              |:.|..:|:      :|..||.       .|....::.:..|..:...|||..|:|.:...:|
Human   313 LGLNDRAQEGD------WRWLDGSPVTLSFWEPEEPNNIHDEDCATMNKGGTWNDLSCYKTTYWI 371

  Fly   291 CE 292
            ||
Human   372 CE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13587NP_611939.1 CLECT 160..293 CDD:153057 33/148 (22%)
CLEC17ANP_001191047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119 64/327 (20%)
CLECT_DC-SIGN_like 254..374 CDD:153060 38/188 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.