DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13587 and CLEC10A

DIOPT Version :9

Sequence 1:NP_611939.1 Gene:CG13587 / 37930 FlyBaseID:FBgn0035031 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_011521915.1 Gene:CLEC10A / 10462 HGNCID:16916 Length:319 Species:Homo sapiens


Alignment Length:200 Identity:41/200 - (20%)
Similarity:54/200 - (27%) Gaps:68/200 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 CIPEVGLFVVYTQPSAYLNASLTC------SNSSEFTGSLAHIASEHRTSLLAQWLVE------F 205
            |:|.....::..|........|||      :|..|        ||...|.....|:..      |
Human   142 CVPVHSEMLLRVQQLVQDLKKLTCQVATLNNNGEE--------ASTEGTCCPVNWVEHQDSCYWF 198

  Fly   206 NRKSQSLAEGNVYL--------------------AYVGLAYNSSTSLSP---------LDFRNSQ 241
            :....|.||...|.                    .|:|.||.......|         .|:... 
Human   199 SHSGMSWAEAEKYCQLKNAHLVVINSREEQNFVQKYLGSAYTWMGLSDPEGAWKWVDGTDYATG- 262

  Fly   242 GESLQCFLYRAWDGGHPR--VGGDLGNA-SCVALTPQGTWQTLNCDRELPFICEIHTARSTFGWE 303
                    ::.|..|.|.  .|..||.. .|....|.|.|....|.|...::||.       |..
Human   263 --------FQNWKPGQPDDWQGHGLGGGEDCAHFHPDGRWNDDVCQRPYHWVCEA-------GLG 312

  Fly   304 QSSSE 308
            |:|.|
Human   313 QTSQE 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13587NP_611939.1 CLECT 160..293 CDD:153057 34/176 (19%)
CLEC10AXP_011521915.1 Lectin_N 18..170 CDD:281887 6/27 (22%)
CLECT_DC-SIGN_like 184..308 CDD:153060 24/132 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.