Sequence 1: | NP_611939.1 | Gene: | CG13587 / 37930 | FlyBaseID: | FBgn0035031 | Length: | 324 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011521915.1 | Gene: | CLEC10A / 10462 | HGNCID: | 16916 | Length: | 319 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 41/200 - (20%) |
---|---|---|---|
Similarity: | 54/200 - (27%) | Gaps: | 68/200 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 CIPEVGLFVVYTQPSAYLNASLTC------SNSSEFTGSLAHIASEHRTSLLAQWLVE------F 205
Fly 206 NRKSQSLAEGNVYL--------------------AYVGLAYNSSTSLSP---------LDFRNSQ 241
Fly 242 GESLQCFLYRAWDGGHPR--VGGDLGNA-SCVALTPQGTWQTLNCDRELPFICEIHTARSTFGWE 303
Fly 304 QSSSE 308 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13587 | NP_611939.1 | CLECT | 160..293 | CDD:153057 | 34/176 (19%) |
CLEC10A | XP_011521915.1 | Lectin_N | 18..170 | CDD:281887 | 6/27 (22%) |
CLECT_DC-SIGN_like | 184..308 | CDD:153060 | 24/132 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |