DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pio and qsm

DIOPT Version :9

Sequence 1:NP_001163295.1 Gene:pio / 37929 FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:379 Identity:84/379 - (22%)
Similarity:136/379 - (35%) Gaps:81/379 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SVRIKCLSGSMLITI--KDAPPNHETGLFSGMIYPKGLS--KNSTCLSEYRDHVGSLRYKLP--- 119
            |.::.|....|.:.|  .||....::   :..||.:||.  .:..|..:....:...|..|.   
  Fly    26 SHKVHCSEDQMRVDIGLPDAESKDQS---APQIYLEGLKGYPDERCQPQIDGSLAVFRLSLSDFY 87

  Fly   120 ----LRSCNTMPKETDDGGIEFFNTIVLQP-------HLKLITDLGRGYHVRCAYKSRDAAMKPK 173
                .|..|.:     .|...:::.|:::.       .:|.||.....|:|.....:..::....
  Fly    88 ECGVTRMVNQL-----TGKKVYYHKIIIESTSGKEIVSVKCITTASPAYNVMMNATTGSSSTSTS 147

  Fly   174 K----YLRKHAQKPQAFRSDDRREYGRSLDKQQDDDLDEEDVYDANAPTQEEDVTNNEIPMPGCH 234
            .    .|.|....|..|:..:..|...||.|:                          .|.|...
  Fly   148 SGGIHGLVKRDVLPAGFQEPEDLEITTSLTKR--------------------------APEPRLS 186

  Fly   235 MKIYNDEHKIADD--VKIGDPLTIVISIDKQK--VYGLHVTDCIVRDGLGWGEQRLVGEDGCPMD 295
            :.:..|..|...|  ||.|.|||:.|::|:..  ||||.|....|.|.....|..:.  .||.:|
  Fly   187 IGVSQDGQKFTRDLTVKSGTPLTMEINLDEDSAPVYGLGVNYLDVTDTHTSSETLIF--KGCTVD 249

  Fly   296 NEIMGQFNYTQDRLAANVTFPAHKFPYTTSVYYQCNVRLCALEDPTCQEAPQCS------GKRPK 354
            ..:...|| |.|....:..|.|.|||.::.|.::..|.:|.   ..|. ..|||      |:|.:
  Fly   250 PYLFENFN-TIDGDILSAKFKAFKFPDSSYVQFRATVNVCL---DKCL-GTQCSNNQVGFGRRKR 309

  Fly   355 RQAAADSKEEDGLPATIEVFSGLYVNENENANDSDEDAVYKEKTLDDALCVSQR 408
            ..::|:...|..|...::|.....||:||        .:..|:.|.:....:||
  Fly   310 EISSANKVYEISLAMFLQVQDIEGVNKNE--------VLQLEEKLRELKLANQR 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pioNP_001163295.1 ZP 66..349 CDD:214579 67/308 (22%)
Zona_pellucida <248..349 CDD:278526 33/102 (32%)
qsmNP_001286637.1 ZP 30..298 CDD:214579 67/308 (22%)
Zona_pellucida <200..300 CDD:278526 35/106 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473241
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.