DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pio and CG17111

DIOPT Version :9

Sequence 1:NP_001163295.1 Gene:pio / 37929 FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_651119.2 Gene:CG17111 / 42727 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster


Alignment Length:481 Identity:103/481 - (21%)
Similarity:176/481 - (36%) Gaps:116/481 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QSSLSDAIAAAEAEVASTSKPAV---EPSV---RIKCLSGSML-----ITIKDAPPNHETGLFSG 90
            |.|||:.:..:| ::.|....::   |.||   |:|||...:.     :|||..|.:    .|.|
  Fly   312 QLSLSECLLHSE-DIVSLGPRSLKLRENSVYMRRVKCLDVRVFCTRDEMTIKYNPKD----WFVG 371

  Fly    91 MIYPKGLSKNSTCLSEYRDHVGSLRYKLPLRS------CNTMP--KETDDGGIEFFNT-IVLQPH 146
            .||....||:  ||:....: ||:...|.:.|      |..:.  :.|.:....|.:. :|:|.:
  Fly   372 KIYASMHSKD--CLARGSGN-GSVLLTLQIGSEVKENRCGILRAYEMTQEYQRTFISALVVIQNN 433

  Fly   147 LKLITDLGRGYHVRCAYKS---------RDAAMKPKKYLRKHAQKPQAFRSDDRREYGRSLDKQQ 202
            ..:.|...|...|.|...:         ||:::...:.:      |.|...:...||...:    
  Fly   434 PNVQTQGDRLIKVGCIQSNATTSLGVSVRDSSVDSSEPV------PSAIALESSLEYTEHM---- 488

  Fly   203 DDDLDEEDVYDANAPTQEEDVTNNEIPMPGCHMKIYNDEHK-IADDVKIGD--PLTIVISIDKQK 264
               ...|.|...|:.|...       |.|...::|.:..|: ..:||:||.  .|.||.....|:
  Fly   489 ---FPHEGVVHYNSSTGPH-------PHPSISLQILDLSHQHETNDVQIGQNLELQIVAEYSPQQ 543

  Fly   265 VY-----------GLHVTDCIVRDGLGWGEQRLVGEDGCPMDNEIMGQFN--YTQDRLAANVTFP 316
            :.           ....|..:.:.........|:.|.|||.|..:.....  :|..|......|.
  Fly   544 LAEHMELQLAPLPDFRATSLVAKTADNENFVLLIDERGCPTDASVFPALERVHTASRSMLRARFH 608

  Fly   317 AHKFPYTTSVYYQCNVRLCALEDPTCQEAPQCSGKRPKRQAAADSKEEDGLPATIEVFSGLYVN- 380
            |.||..|.:|.:...:|.|.   ..|..:...|....:|:..||  :.|..|..:.|.:.:|:: 
  Fly   609 AFKFSGTANVSFDVKIRFCV---ERCSPSNCISSSWQRRRRQAD--QPDRRPEDLRVQNPVYIST 668

  Fly   381 ------ENENANDSDEDA-------------------VYKEK------TLDDAL-----CVSQRT 409
                  :.:|...|.|:.                   :|.|:      .:||.|     |::| :
  Fly   669 VVDVAPQPDNFTRSQEELPLNYNIRVHGPDQSNTNSYLYGERGVLLIAGIDDPLHLDNVCINQ-S 732

  Fly   410 FAIAIAIAGLILMLAVVAAVLCIMAR 435
            ..||:.|..||..:|::.....::.|
  Fly   733 LLIALFIFWLICQVALLFGCGMVLQR 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pioNP_001163295.1 ZP 66..349 CDD:214579 68/321 (21%)
Zona_pellucida <248..349 CDD:278526 25/115 (22%)
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532 9/32 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473245
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.