DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pio and CG10005

DIOPT Version :9

Sequence 1:NP_001163295.1 Gene:pio / 37929 FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_650137.3 Gene:CG10005 / 41451 FlyBaseID:FBgn0037972 Length:231 Species:Drosophila melanogaster


Alignment Length:127 Identity:30/127 - (23%)
Similarity:57/127 - (44%) Gaps:23/127 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 EAEVASTSKPAVEPS------VRIKCLSGSMLITIKDAPPNHETGLFSGMIYPKG--LSKNSTCL 104
            |.:::.|.|  :|.|      |.:||.:.||.:.::...|      |.|::|.:|  ..:::.|.
  Fly    37 EQDLSDTFK--IEGSDQGIQKVNLKCGADSMNVVLETEKP------FMGVMYTRGSFYKQSAPCF 93

  Fly   105 SEYRDHVGS--LRYKLPLRSCNTMPKETDDGGIEFFNTIVLQPHLKLITDLGRGYHVRCAYK 164
            .:.....||  :.....|..|.|:    .||.: :.|.:|:|...:|||.....:.:.|.::
  Fly    94 MKPSSSQGSRTMEMNFQLDQCQTI----RDGDL-YTNIVVIQNDPELITPGDSAFSLECDFR 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pioNP_001163295.1 ZP 66..349 CDD:214579 24/103 (23%)
Zona_pellucida <248..349 CDD:278526
CG10005NP_650137.3 ZP 59..>162 CDD:214579 24/103 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473244
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.