DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pio and zye

DIOPT Version :9

Sequence 1:NP_001163295.1 Gene:pio / 37929 FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_649220.1 Gene:zye / 40255 FlyBaseID:FBgn0036985 Length:2284 Species:Drosophila melanogaster


Alignment Length:399 Identity:83/399 - (20%)
Similarity:149/399 - (37%) Gaps:100/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 HLITIAAL--TTHAAQIPTAMKDAQSSLSDAIAAAEAEVAS------TSKPA--VEPSVRIKCLS 69
            |:...|.|  ||..    |.:.| ..:|:|.:...|.:.:|      ||..|  :| .:.:||..
  Fly     6 HIFVWALLLVTTRG----TDLSD-DEALNDVLGELEFDDSSPRLTRDTSLSAKHIE-KIDVKCDQ 64

  Fly    70 GS-MLITIKDAPPNHETGLFSGMIYPKGLSKNSTCLSEYRDHVG-SLRYKLPLRSCNTMPKETDD 132
            || |::.::.:..      |.|:||.:|...:..|.....|..| |..:.:|...|.:.|..:..
  Fly    65 GSGMMVEVEFSED------FEGVIYSQGYFSDPKCNYVKGDRSGRSFTFTVPYDGCGSKPSCSVC 123

  Fly   133 GGIEFFNTIVLQPHLKLITDLGRGYHVRCAYKSRDAAMKPKKYLRKHAQKPQAFRSDDRREYGRS 197
            ..||  |.:::|..    .|:...:.:                    |:|....|.|:|      
  Fly   124 ASIE--NILIIQDD----RDIQNSFDI--------------------ARKISCSRGDER------ 156

  Fly   198 LDKQQDDDLDEEDVYDANAPTQEEDVTNNEIPM--PGCHMKIYN----DEHKIADDVKIGDPLTI 256
                      |:.||.........:|.:.:.|.  ..|.|:|..    :...|...:.:|..:|.
  Fly   157 ----------EKTVYFKPFVVDMLEVISVDTPSGPVECWMEIGTGTPPNVKPIQGTLTLGTDITF 211

  Fly   257 VISI-DKQKVYGLHVTDCIVRDGLGWGEQ-----RLVGEDGCPMDNEIMGQFNYTQDRLAANVTF 315
            .|:: ..::.:.:::..|...|.:.:..:     :|..:.||.:..:|.|::...:...:...|:
  Fly   212 TINVKHSEQAWDINILQCYASDDMDFEARTTKRLQLSDKRGCSIKEKIFGEWRKFEAGSSLTSTY 276

  Fly   316 ----PAHKFPYTTSVYYQCNVRLC-----------ALEDPTCQEA---PQCSGKR---PKRQAAA 359
                .|.:||..:.||.:|::.||           :|...||.|.   |||....   ||.:...
  Fly   277 YNTLKAFRFPDRSQVYLKCDIELCNGACKRDYTCGSLRSLTCPEGSTDPQCLQDHLISPKPRCYP 341

  Fly   360 DSKEEDGLP 368
            .| .|.|.|
  Fly   342 GS-NEPGCP 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pioNP_001163295.1 ZP 66..349 CDD:214579 61/314 (19%)
Zona_pellucida <248..349 CDD:278526 25/124 (20%)
zyeNP_649220.1 ZP 61..313 CDD:214579 55/299 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473281
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.