DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pio and T01D1.8

DIOPT Version :9

Sequence 1:NP_001163295.1 Gene:pio / 37929 FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001300591.1 Gene:T01D1.8 / 3896729 WormBaseID:WBGene00044641 Length:189 Species:Caenorhabditis elegans


Alignment Length:140 Identity:35/140 - (25%)
Similarity:65/140 - (46%) Gaps:20/140 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 PMPGCHMKIYNDEHK----IADDVKIGDPL----TIVISID-KQKVYGLHVTDCIVRDG----LG 280
            |.|.|...:::...|    :...|.|||.:    ....|.| |..::.:.|.:|.:.|.    :|
 Worm    47 PEPECKYSVHHGSDKLGRIVTSKVNIGDEIYHSWNCNYSGDHKNYLFCVMVNNCTISDSGEEEIG 111

  Fly   281 WGEQRLVGEDGCPMDNEIMGQFNYTQDRLAANVTFPAHKFPY---TTSVYYQCNVRLCALEDPTC 342
            ..:.:::.|:||.:...|:...:|..| |:|.:  ..|.|..   ||:|::.||:::...:...|
 Worm   112 TRKIQIIDENGCSVFPNILPDISYQGD-LSAGI--KVHAFALDVDTTAVHFTCNIKMLFKDHEQC 173

  Fly   343 QEAPQCSGKR 352
            |. |:|..:|
 Worm   174 QR-PRCGNQR 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pioNP_001163295.1 ZP 66..349 CDD:214579 33/135 (24%)
Zona_pellucida <248..349 CDD:278526 29/112 (26%)
T01D1.8NP_001300591.1 Zona_pellucida <39..179 CDD:391783 33/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376126at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.