DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pio and CG15020

DIOPT Version :9

Sequence 1:NP_001163295.1 Gene:pio / 37929 FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_647901.1 Gene:CG15020 / 38544 FlyBaseID:FBgn0035543 Length:604 Species:Drosophila melanogaster


Alignment Length:421 Identity:92/421 - (21%)
Similarity:157/421 - (37%) Gaps:121/421 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 GLFSGMIYPKGLSKNSTCL---SEYRDHVGSLRYKLPLRSCNTMPK-----ETDDGGIEF-FNTI 141
            |.|||::|..|.:.:..|:   ...||:   ..:.:.|..|.|:.|     |:......| :||:
  Fly   237 GSFSGLLYSAGYAYDPDCMYINGSGRDY---YEFYIQLNRCGTLGKNSLQEESRKNPTNFMWNTV 298

  Fly   142 VLQPHLKLITDLGRGYHVRCAYKSRDAAMKPKKYLRKHAQKPQAFRSDDRREYGRSLDKQQDDDL 206
            .:|.:..:..:....:.|.|                               |||           
  Fly   299 TVQYNPLIEEEYDEHFKVTC-------------------------------EYG----------- 321

  Fly   207 DEEDVYD----ANAPTQEEDV-TNNEIPM----PGCHMKIYN----DEHKIADDVKIGDPLTIVI 258
                 ||    ...|..:.:| |.|.:..    |.|:|:|.|    ...::...|::|||||::|
  Fly   322 -----YDFWKTVTFPFLDVEVATGNPVVFTLSPPECYMEIQNGYGIGGPRVTGPVRVGDPLTLII 381

  Fly   259 SI-DKQKVYGLHVTDCIVRDGLGWGEQRLVGEDGCPMDNEIMGQFN--------YTQDRLAANVT 314
            .: .|...:.:.|.||...:|.....| |:.:.|||:|::::.:|.        |.....|...|
  Fly   382 YMRSKYDGFDIVVNDCYAHNGANKRIQ-LIDQHGCPVDDKLISRFRGSWSDSGVYETQVYAYMKT 445

  Fly   315 FPAHKFPYTTSVYYQCNVRLCALEDPTCQEAPQCSGKRPKRQAAADSK------------EEDGL 367
            |   :|..:.::|.:|:||:|   ...|...| |..:..|.....|:.            ..||.
  Fly   446 F---RFTGSPALYIECDVRMC---HGRCPSQP-CHWRNLKAVTKRDTSNMTATNISIPPLSADGE 503

  Fly   368 PATIEVFSGLYVNENEN---------ANDSDEDAVY---KEKTLD-DALCVSQRTF-AIAIAIAG 418
            ..|.|..:...::||.|         ..::|.|.||   :.|.|. ...|:...|| |:....:.
  Fly   504 GLTTESPTANSLSENVNLFQSLRVLQEGETDGDDVYAHRQTKPLSPHQTCLKTSTFSALTAGCSA 568

  Fly   419 LILMLAVVAAVLCIMARRSTKTVSNSGSSIY 449
            ::.:|.|...:.|...:|..:      ||:|
  Fly   569 VLCVLTVTLFIACSRLKRRKE------SSLY 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pioNP_001163295.1 ZP 66..349 CDD:214579 65/293 (22%)
Zona_pellucida <248..349 CDD:278526 31/109 (28%)
CG15020NP_647901.1 ZP 223..473 CDD:214579 65/293 (22%)
Zona_pellucida <371..472 CDD:278526 31/108 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473251
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.