DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pio and dyl

DIOPT Version :9

Sequence 1:NP_001163295.1 Gene:pio / 37929 FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_647890.2 Gene:dyl / 38531 FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster


Alignment Length:400 Identity:90/400 - (22%)
Similarity:156/400 - (39%) Gaps:96/400 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ALHLITIAALTTHAAQI--PTAMKDA-QSSLSDAIAAAEAE----VASTSKPAVEPSVRIKCLSG 70
            |.|:.:.|....|.|..  |..:..| |..||.......:|    :|||:.......::::|...
  Fly    30 ASHIESAALPLEHRAGYGPPAPIYGAPQGPLSTGATNDVSEEAWPLASTNDSPQIKHLQVQCEKT 94

  Fly    71 SMLITIK-DAPPNHETGLFSGMIYPKGLSKNSTC--LSEYRDHVGSLRYKLPLRSCNTMPKETDD 132
            .|.:.|: |.|       |.|||:.||...:..|  |.....|: |..:::.|.||........:
  Fly    95 HMRVNIEFDRP-------FYGMIFSKGFYSDPHCVHLKPGTGHL-SATFEIFLNSCGMTSSANHN 151

  Fly   133 ---------GGIEFFNTIVLQ--PHLKLITDLGRGYHVRCA---YKSRDAAMKPKKYLRKHAQKP 183
                     .|....|||::|  |:::.:.|..|  .:||.   :..:....:|.:....||...
  Fly   152 AAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQAR--KLRCTWYDFYEKAVTFRPFQVDMLHAVTA 214

  Fly   184 QAFRSDDRREYGRSLDKQQDDDLDEEDVYDANAPTQEEDVTNNEIPMPGCHMKIYNDE----HKI 244
            . |..|:.:                                        |.|:|...:    .::
  Fly   215 N-FLGDNLQ----------------------------------------CWMQIQVGKGPWASEV 238

  Fly   245 ADDVKIGDPLTIVISI-DKQKVYGLHVTDCIVRDGLGWGEQRLVGEDGCPMDNEIMGQFNYTQD- 307
            :..||||..:|:|::| |.:..:.:.|.:|:..||.. ...:||.::||.:..:||.:|...:: 
  Fly   239 SGIVKIGQTMTMVLAIKDDENKFDMLVRNCVAHDGKR-APIQLVDQNGCVVRPKIMSKFQKIKNF 302

  Fly   308 ----RLAANVTFPAHKFPYTTSVYYQCNVRLCALEDPTCQEAPQC-----SGKRPKRQAAADS-K 362
                .:.:...|.|.|||.:.:|::||.:::|..   .|.| |:|     .|:....|..|:. .
  Fly   303 GPSASVVSFAYFQAFKFPDSMNVHFQCVIQVCRY---NCPE-PKCGPGLPGGEYGLPQIGANGLS 363

  Fly   363 EEDGLPATIE 372
            ||.|.|...|
  Fly   364 EEYGPPEAYE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pioNP_001163295.1 ZP 66..349 CDD:214579 68/314 (22%)
Zona_pellucida <248..349 CDD:278526 32/111 (29%)
dylNP_647890.2 ZP 90..345 CDD:214579 68/310 (22%)
PHA03378 <339..494 CDD:223065 10/35 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473252
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.