DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pio and cutl-23

DIOPT Version :9

Sequence 1:NP_001163295.1 Gene:pio / 37929 FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_001317785.1 Gene:cutl-23 / 189610 WormBaseID:WBGene00021343 Length:773 Species:Caenorhabditis elegans


Alignment Length:332 Identity:74/332 - (22%)
Similarity:122/332 - (36%) Gaps:67/332 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EVASTSKPAVEPSVRIKCLSGSMLITIKDAPPNHETGLFSGMIYPKGLSKNSTCLSEYRDHVGSL 114
            |:...:||.|..:..:||...||.|.::      ......|::|.........|:....|:...:
 Worm   436 ELPPDAKPQVRGATDVKCTEHSMSIVVR------TQRALQGVMYAHMYHDEPECMIRKTDNSREI 494

  Fly   115 RYKLPLRSCNTMPKETDDG-GIEFFNTIVLQPHLKLITDLGRGYHVRCAYKSRDAAMKPKKYLRK 178
            :.......|..:...|.|| |..|..|::||.|..:||...:|..:.|...|             
 Worm   495 QMTFTEGKCGLVKTPTADGHGYHFNITVILQFHPLIITRADQGLDMSCFVSS------------- 546

  Fly   179 HAQKPQAFRSDDRREYGRSLDKQQDDDLDEEDVYDANAPTQEEDVTNNEIPMPGCHMKIYNDEHK 243
                     :..|:|..|::.|   :..|.:.||                     .:..|:....
 Worm   547 ---------AVPRQELDRAVLK---NAADTQCVY---------------------RLHRYSPGQC 578

  Fly   244 IADDVKIGDPLTIVISIDKQKVYGLHVTDCIVRDGLGWGEQRLVGEDGCPMDNEIMGQFNYT--Q 306
            :|.|.|:|:.|....:.|....|...|.||.|:...  ..|:::..:||.:|...:...||:  :
 Worm   579 VALDAKVGETLYHRWACDSPPEYNYLVHDCFVQSEK--HTQQILDSNGCEVDQHFLETPNYSRFK 641

  Fly   307 DRLAANVTF---PAHKFPYTTSVYYQCNVRLCALEDPT--CQEA--PQCSGK---RPKRQAAADS 361
            |....:..|   ...|||....:.:.|.:.||.:.||.  |.::  |:|..|   .|.||..:.|
 Worm   642 DYPEDSYVFQEMSVFKFPGDGDLLFHCKISLCNMNDPNAPCNQSIPPKCPKKVPVLPVRQKRSVS 706

  Fly   362 KEEDGLP 368
            .||...|
 Worm   707 AEEMASP 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pioNP_001163295.1 ZP 66..349 CDD:214579 61/292 (21%)
Zona_pellucida <248..349 CDD:278526 27/109 (25%)
cutl-23NP_001317785.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I6139
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22907
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.