DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pio and ram-5

DIOPT Version :9

Sequence 1:NP_001163295.1 Gene:pio / 37929 FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_510422.2 Gene:ram-5 / 181550 WormBaseID:WBGene00004301 Length:711 Species:Caenorhabditis elegans


Alignment Length:120 Identity:29/120 - (24%)
Similarity:54/120 - (45%) Gaps:19/120 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 VTDCIVRDGLGWGEQ--RLVGEDGCPMDNEIMGQFNYTQ--DRLAANVTFPAHKFPYTTSVYY-- 328
            :|:|   :.|....|  .|:.|:||.:|:|:||...|:.  .:|.|.    |..|.:.|...|  
 Worm   183 LTNC---NALSQNGQIIHLIDENGCVIDSELMGDIVYSDHVPKLYAR----ARIFKFLTDDKYRI 240

  Fly   329 QCNVRLCALEDPTCQE---APQCSGKRPK--RQAAADSKEEDGLPATIEVFSGLY 378
            :|.:..|....| |::   .|:|:..:.:  .::..:..|:.|:.....:.|..|
 Worm   241 ECTLEFCNNGSP-CKDRVFPPKCAFTKEEITSRSTKNQLEQSGMTTMPGIPSSAY 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pioNP_001163295.1 ZP 66..349 CDD:214579 24/87 (28%)
Zona_pellucida <248..349 CDD:278526 24/87 (28%)
ram-5NP_510422.2 Zona_pellucida 36..264 CDD:391783 25/88 (28%)
PRK13042 522..>590 CDD:183854
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376126at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22907
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.