DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment pio and cutl-15

DIOPT Version :9

Sequence 1:NP_001163295.1 Gene:pio / 37929 FlyBaseID:FBgn0020521 Length:462 Species:Drosophila melanogaster
Sequence 2:NP_495904.2 Gene:cutl-15 / 174426 WormBaseID:WBGene00011888 Length:385 Species:Caenorhabditis elegans


Alignment Length:211 Identity:47/211 - (22%)
Similarity:81/211 - (38%) Gaps:41/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 QKVYGLHVTDCIVRDG--LGWGEQ--RLVGEDGCPMDNEIMGQFNYTQDRLAANVTFPAHKFPYT 323
            |.||    ..||:.:.  |..||:  .::...||.....||.|..| .:|.....:.......:|
 Worm   187 QNVY----ESCIMIENCELVGGEETHEVIDSSGCSKHESIMPQLEY-HNRTHVGTSVKVFGVSHT 246

  Fly   324 TSVYYQCNVRLCALEDPT--CQEAPQCSGKRPKRQAAADSKEEDGLPATIEVFSGLYVN------ 380
            :.||:.|.|||.. :.||  |.: |:|...|.||:.::.....|.....:|:...:.:.      
 Worm   247 SIVYFACQVRLHP-QLPTGECPK-PKCDLMRRKREDSSQFPSIDVRSQNLEISQLINITSSTMTP 309

  Fly   381 ----------------ENENANDSDEDAVYKEKTLD-DALCVSQRTFAIAIAIAGLILMLAVVAA 428
                            |.|:..::.|     .|.|| :.:|...|:..:...:..:.|:|.....
 Worm   310 HPTEPPIQHTCPDIHVETESIEEASE-----SKALDEERICADFRSVLVVSILLTVALILITTTI 369

  Fly   429 VLCIMARRSTKTVSNS 444
            |:.|:.|:..:..|.|
 Worm   370 VILIVRRQKYEIASMS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pioNP_001163295.1 ZP 66..349 CDD:214579 26/91 (29%)
Zona_pellucida <248..349 CDD:278526 26/91 (29%)
cutl-15NP_495904.2 ZP 41..272 CDD:214579 26/91 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D376126at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22907
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.