DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and STARD5

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_871629.1 Gene:STARD5 / 80765 HGNCID:18065 Length:213 Species:Homo sapiens


Alignment Length:92 Identity:26/92 - (28%)
Similarity:45/92 - (48%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   482 VGKTKDRVWVTSAVSVQYAAVPPSPKYTRGQNIVSGFAFREIVGKSDSCIVEWVLCLDLKGYIPR 546
            |.:.:|....::|..|::...||.|.:.||.|...|.....:.|:.....:......||.||:|:
Human   122 VKRYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQ 186

  Fly   547 YVLDAALTSSMTDYISNLRKHVNELRQ 573
            .|:|:....|||.:.:||:|.|.:..:
Human   187 NVVDSFFPRSMTRFYANLQKAVKQFHE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435
SRPBCC 247..571 CDD:301327 26/88 (30%)
STARD5NP_871629.1 START_STARD5-like 6..211 CDD:176912 26/88 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141905
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.