DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and stard5

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_017212459.1 Gene:stard5 / 796844 ZFINID:ZDB-GENE-130103-4 Length:209 Species:Danio rerio


Alignment Length:283 Identity:54/283 - (19%)
Similarity:91/283 - (32%) Gaps:98/283 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 MED--LFYRIEDCPKWNPALLESKIVRKINSYTDITYQVSVGGGGGMVKSRDFVN---------- 357
            :||  |.|| :|...|       |..:|.|... :.::.|....|.:.|....||          
Zfish    10 VEDRLLSYR-KDESGW-------KTCKKTNDVV-VYWRPSCEFAGNVYKGEGIVNFSPEKVWDCL 65

  Fly   358 ---LRSCRLFYNGQICDDDETAQLSSDDGNSSLNRSCEGSVSTISDGDSNTPLLPSSVSSCKATF 419
               :...|:.::..|...:...|:|:|                              |..|:...
Zfish    66 KPEINGLRVKWDANIKKFELVEQVSAD------------------------------VLICRTVT 100

  Fly   420 PTSSKGAAMPFDTLGNSLGAKSLGPIVNFDEEPPPLDQDEFEDAKDKVDGEANNMTKPNVPSVGK 484
            |:::.|...|                                  :|.||          |.|:.:
Zfish   101 PSAAMGIISP----------------------------------RDFVD----------VISIKR 121

  Fly   485 TKDRVWVTSAVSVQYAAVPPSPKYTRGQNIVSGFAFREIVGKSDSCIVEWVLCLDLKGYIPRYVL 549
            .:|....::|.:|.:...||...:.||.|...|.....:.|......:......||.|.:||.|:
Zfish   122 YEDGTVSSNATNVSHPDCPPQNGFVRGFNHPCGCMCVPVPGDPSKTQLFSFFQTDLGGLLPRSVV 186

  Fly   550 DAALTSSMTDYISNLRKHVNELR 572
            |:...:||.::.:||.|.|..|:
Zfish   187 DSFFPTSMVEFYNNLTKAVKSLK 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435
SRPBCC 247..571 CDD:301327 53/280 (19%)
stard5XP_017212459.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.