DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and Stard3nl

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_030103314.1 Gene:Stard3nl / 76205 MGIID:1923455 Length:318 Species:Mus musculus


Alignment Length:251 Identity:90/251 - (35%)
Similarity:129/251 - (51%) Gaps:50/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 STAQLILANARQGNSAYNMQYDMSRAHSINLITEDFLAGYMQ----------------------- 52
            |.|:|:|  .|.|...:.:....||.:.:....|:.|.|...                       
Mouse    33 SPAKLLL--TRDGGVGWRLLQSSSRMNHLPEHMENTLTGSQSSHASLRDIHSINPAQLMARIESY 95

  Fly    53 DGR----MSVVRRFFCLFVTFDLVFVSLLWLICIVINGDNIFTAFHKQIVEYTIYKSLFDVVAVA 113
            :||    :|.|||.|||||||||:||:|||:|.:.:|| .|.....|:::.|..|.|.||:..:|
Mouse    96 EGREKKGISDVRRTFCLFVTFDLLFVTLLWIIELNVNG-GIENTLKKEVIHYDYYSSYFDIFLLA 159

  Fly   114 ICRFLVLIFFYAILYINHWSIIALSTSGSCLFLISKVFVFDWLDSK---QQVFEVILIITSFILA 175
            :.||.|||..||:..:.||..|||:|:.:..||::||.:     ||   |..|..:|.|.|||||
Mouse   160 VFRFKVLILGYAVCRLRHWWAIALTTAVTSAFLLAKVIL-----SKLFSQGAFGYVLPIISFILA 219

  Fly   176 WGEAWFLDCRVIPQERHAQHYFRTMTSNDRTPMEQPAILIEQERPPQSVTD--FYS 229
            |.|.||||.:|:|||  |:...|.:...|.:  |:.|::      |..::|  |||
Mouse   220 WIETWFLDFKVLPQE--AEEENRLLLVQDAS--ERAALI------PAGLSDGQFYS 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435 77/178 (43%)
SRPBCC 247..571 CDD:301327
Stard3nlXP_030103314.1 MENTAL 104..268 CDD:371066 77/178 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831951
Domainoid 1 1.000 124 1.000 Domainoid score I5513
eggNOG 1 0.900 - - E1_KOG3845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437203at2759
OrthoFinder 1 1.000 - - FOG0001150
OrthoInspector 1 1.000 - - otm42979
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46121
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3785
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.840

Return to query results.
Submit another query.