Sequence 1: | NP_001246495.1 | Gene: | Start1 / 37927 | FlyBaseID: | FBgn0035028 | Length: | 583 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_083066.1 | Gene: | Acot12 / 74156 | MGIID: | 1921406 | Length: | 556 | Species: | Mus musculus |
Alignment Length: | 211 | Identity: | 52/211 - (24%) |
---|---|---|---|
Similarity: | 81/211 - (38%) | Gaps: | 41/211 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 261 IIESSDWKVEKVNQKGDTIHSTQRDKIG-KIYKLTARIKYPAKALMEDLFYRIEDCPKWNPALLE 324
Fly 325 SKIVRKINSYTDITY-QVSVGGGGGMVKSRDFVNLRSCRLFYNGQICDDDET-------AQLSSD 381
Fly 382 DGNSSLNRS---CEGSVSTISDGDSNTPLLPSSVSSCKATFPTSSKGAAMPFDTLGNSLG-AKSL 442
Fly 443 ----GPIVNFDEEPPP 454 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Start1 | NP_001246495.1 | MENTAL | 57..232 | CDD:287435 | |
SRPBCC | 247..571 | CDD:301327 | 52/211 (25%) | ||
Acot12 | NP_083066.1 | BFIT_BACH | 4..116 | CDD:239526 | |
Coenzyme A binding. /evidence=ECO:0000250 | 54..56 | ||||
Coenzyme A binding. /evidence=ECO:0000250 | 83..85 | ||||
BFIT_BACH | 182..306 | CDD:239526 | |||
Coenzyme A binding. /evidence=ECO:0000250 | 235..237 | ||||
SRPBCC | 312..547 | CDD:387369 | 51/207 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |