DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and Acot12

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_083066.1 Gene:Acot12 / 74156 MGIID:1921406 Length:556 Species:Mus musculus


Alignment Length:211 Identity:52/211 - (24%)
Similarity:81/211 - (38%) Gaps:41/211 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 IIESSDWKVEKVNQKGDTIHSTQRDKIG-KIYKLTARIKYPAKALMEDLFYRIEDCPKWNPALLE 324
            :...|.|::....:|.......::|.|. |:.||.....:.|..|:.||..|    |.|:|..:.
Mouse   363 LASKSGWEITTTLEKIKIYTLEEQDAISVKVEKLVGSPAHIAYHLLSDLTKR----PLWDPHYIS 423

  Fly   325 SKIVRKINSYTDITY-QVSVGGGGGMVKSRDFVNLRSCRLFYNGQICDDDET-------AQLSSD 381
            .:::.:::....|.| ..||..|.   |.:|||.|.|.|     :...|:.|       ..|.|.
Mouse   424 CEVIDQVSEDDQIYYITCSVVNGD---KPKDFVVLVSRR-----KPLKDNNTYTVALRSVVLPSV 480

  Fly   382 DGNSSLNRS---CEGSVSTISDGDSNTPLLPSSVSSCKATFPTSSKGAAMPFDTLGNSLG-AKSL 442
            ..:....||   |.|.:  |...|||         ||..|:......:.:|: ..||..| :||:
Mouse   481 PSSPQYIRSEVICAGFL--IQAVDSN---------SCTVTYLNQMSDSILPY-FAGNIGGWSKSI 533

  Fly   443 ----GPIVNFDEEPPP 454
                ...:.|.|...|
Mouse   534 EEAAASCIKFIENATP 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435
SRPBCC 247..571 CDD:301327 52/211 (25%)
Acot12NP_083066.1 BFIT_BACH 4..116 CDD:239526
Coenzyme A binding. /evidence=ECO:0000250 54..56
Coenzyme A binding. /evidence=ECO:0000250 83..85
BFIT_BACH 182..306 CDD:239526
Coenzyme A binding. /evidence=ECO:0000250 235..237
SRPBCC 312..547 CDD:387369 51/207 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.