DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and STAR

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_000340.2 Gene:STAR / 6770 HGNCID:11359 Length:285 Species:Homo sapiens


Alignment Length:359 Identity:74/359 - (20%)
Similarity:132/359 - (36%) Gaps:129/359 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 PAILIEQERPPQSVTDFYSLMDTARHSDEEDELDDEYTQMGLDCLRKAYEIIESSD-WKVEKVNQ 274
            |:..|.|.|...|:..  |.::...:||:|    ..|.|.|.:.::||..|:.:.: ||.|....
Human    45 PSTWINQVRRRSSLLG--SRLEETLYSDQE----LAYLQQGEEAMQKALGILSNQEGWKKESQQD 103

  Fly   275 KGDTIHSTQRDKIGKIYKLTARIKYPAKALMEDLFYRIEDCPKWNPALLESKIVRKINSYTDITY 339
            .||.:.|.....:||:::|...:..|.:.|.|:|..|:|...:|||.:.|.|:::||...|.||:
Human   104 NGDKVMSKVVPDVGKVFRLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKIGKDTFITH 168

  Fly   340 QVSVGGGGGMVKSRDFVNLRSCRLFYNGQICDDDETAQLSSDDGNSSLNRSCEGSVSTISDGDSN 404
            :::....|.:|..||||::|..:  ..|..|   ..|.:::|.||                    
Human   169 ELAAEAAGNLVGPRDFVSVRCAK--RRGSTC---VLAGMATDFGN-------------------- 208

  Fly   405 TPLLPSSVSSCKATFPTSSKGAAMPFDTLGNSLGAKSLGPIVNFDEEPPPLDQDEFEDAKDKVDG 469
               :|            ..||                   ::..:..|..:              
Human   209 ---MP------------EQKG-------------------VIRAEHGPTCM-------------- 225

  Fly   470 EANNMTKPNVPSVGKTKDRVWVTSAVSVQYAAVPPSPKYTRGQNIVSGFAFREIVGKSDSCIVEW 534
                :..|...|..|||                                             :.|
Human   226 ----VLHPLAGSPSKTK---------------------------------------------LTW 241

  Fly   535 VLCLDLKGYIPRYVLDAALTSSMTDYISNLRKHV 568
            :|.:||||::|:.:::..|:.:..|:.::|||.:
Human   242 LLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435 6/20 (30%)
SRPBCC 247..571 CDD:301327 65/323 (20%)
STARNP_000340.2 START_STARD1-like 70..278 CDD:176914 67/332 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141904
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437203at2759
OrthoFinder 1 1.000 - - FOG0001150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.