DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and stard4

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:XP_005170291.1 Gene:stard4 / 550374 ZFINID:ZDB-GENE-050417-168 Length:221 Species:Danio rerio


Alignment Length:125 Identity:28/125 - (22%)
Similarity:45/125 - (36%) Gaps:49/125 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   490 WVTSAVSVQYAAVPPS----PKY-TRGQ--NIVSGFAFREIVGKSD------SCIVE-------- 533
            |.:...|::....|..    .|| |.||  ||:|...|.:....|:      ||.|.        
Zfish    94 WDSMMTSMEILETPEQGCCVVKYTTSGQLWNIISPREFVDFSYTSECERGLLSCGVSVDREQHSS 158

  Fly   534 -----------WVLCL----------------DLKGYIPRYVLDAALTSSMTDYISNLRK 566
                       | .|:                ||:|::||..:|.|:.|.:..:.|:|::
Zfish   159 GCVRGFNHACGW-FCVPTDDPSLSLLTGYIQTDLRGHLPRAAVDTAMASGLITFFSDLQR 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435
SRPBCC 247..571 CDD:301327 28/125 (22%)
stard4XP_005170291.1 SRPBCC 29..219 CDD:301327 28/125 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170574799
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.