DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and Stard5

DIOPT Version :10

Sequence 1:NP_611936.2 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001178940.1 Gene:Stard5 / 502348 RGDID:1561783 Length:213 Species:Rattus norvegicus


Alignment Length:171 Identity:39/171 - (22%)
Similarity:66/171 - (38%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   400 DGDSNTPLLPSSVSSCKATFPTSSKGAAMPFDTLGNSLGAKSLGPIVNFDEEPPPLDQDEFEDAK 464
            |.:.|:..:..|::.......||:..|||           |.:.|                   :
  Rat    80 DDNVNSFEIVQSITDTLCVSRTSTPSAAM-----------KLISP-------------------R 114

  Fly   465 DKVDGEANNMTKPNVPSVGKTKDRVWVTSAVSVQYAAVPPSPKYTRGQNIVSGFAFREIVGKSDS 529
            |.||          :..|.|.:|....::|..|::...||.|.:.||.|...|.....:.|:.:.
  Rat   115 DFVD----------LVLVKKYEDGTISSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGEPNK 169

  Fly   530 CIVEWVLCLDLKGYIPRYVLDAALTSSMTDYISNLRKHVNE 570
            ..:......||.||:|:.|:|:....||.::..||:|.|.:
  Rat   170 THLVTFFQTDLNGYLPQSVVDSFFPRSMAEFYPNLQKAVRK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_611936.2 MENTAL 57..233 CDD:463097
SRPBCC 247..571 CDD:472699 39/171 (23%)
Stard5NP_001178940.1 SRPBCC 6..211 CDD:472699 39/171 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.