DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and Stard4

DIOPT Version :10

Sequence 1:NP_611936.2 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001099629.1 Gene:Stard4 / 291699 RGDID:1309475 Length:224 Species:Rattus norvegicus


Alignment Length:76 Identity:20/76 - (26%)
Similarity:42/76 - (55%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 VTSAVSVQYAAVPPSPKYTRGQNIVSGFAFREIVGKSDSCIVEWVLCLDLKGYIPRYVLDAALTS 555
            ::..|||:::..  .|::.||.|...|:....:....:..::...:..||:|.||:..:|.|:.|
  Rat   146 LSCGVSVEWSET--RPEFVRGYNHPCGWFCVPLKDSPNQSLLTGYIQTDLRGMIPQSAVDTAMAS 208

  Fly   556 SMTDYISNLRK 566
            ::.::.|:|||
  Rat   209 TLANFYSDLRK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_611936.2 MENTAL 57..233 CDD:463097
SRPBCC 247..571 CDD:472699 20/76 (26%)
Stard4NP_001099629.1 SRPBCC 21..222 CDD:472699 20/76 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.