DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and Stard4

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001099629.1 Gene:Stard4 / 291699 RGDID:1309475 Length:224 Species:Rattus norvegicus


Alignment Length:76 Identity:20/76 - (26%)
Similarity:42/76 - (55%) Gaps:2/76 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 VTSAVSVQYAAVPPSPKYTRGQNIVSGFAFREIVGKSDSCIVEWVLCLDLKGYIPRYVLDAALTS 555
            ::..|||:::..  .|::.||.|...|:....:....:..::...:..||:|.||:..:|.|:.|
  Rat   146 LSCGVSVEWSET--RPEFVRGYNHPCGWFCVPLKDSPNQSLLTGYIQTDLRGMIPQSAVDTAMAS 208

  Fly   556 SMTDYISNLRK 566
            ::.::.|:|||
  Rat   209 TLANFYSDLRK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435
SRPBCC 247..571 CDD:301327 20/76 (26%)
Stard4NP_001099629.1 SRPBCC 21..222 CDD:301327 20/76 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335622
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.