DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and Stard6

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001007628.1 Gene:Stard6 / 291527 RGDID:1359639 Length:227 Species:Rattus norvegicus


Alignment Length:306 Identity:49/306 - (16%)
Similarity:94/306 - (30%) Gaps:132/306 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 SDWKVEKVNQKGDTIHSTQRDKI--GKIYKLTARI-KYPAKALMEDLFYRIEDCPKWNPALLESK 326
            |.|||.|.::|  ...|::..|:  |.:|::...| :.||.  :.|..|:.|....|:.:|....
  Rat    22 SGWKVVKTSKK--VTVSSKASKLFQGNLYRIEGVIPELPAH--LSDFLYKSEHRVSWDKSLKAFN 82

  Fly   327 IVRKINSYTDITYQVSVGGGGGMVKSRDFVNLRSCRLFYNGQICDDDETAQLSSDDGNSSLNRSC 391
            ::.||:|.|.|.:.::.....|.:..|||::|                 ..:...|||..     
  Rat    83 MIHKIDSDTLICHTITQSFAMGSISPRDFIDL-----------------VHIKHQDGNMD----- 125

  Fly   392 EGSVSTISDGDSNTPLLPSSVSSCKATFPTSSKGAAMPFDTLGNSLGAKSLGPIVNFDEEPPPLD 456
                                                                             
  Rat   126 ----------------------------------------------------------------- 125

  Fly   457 QDEFEDAKDKVDGEANNMTKPNVPSVGKTKDRVWVTSAVSVQYAAVPPSPKYTRGQNIVSGFAFR 521
                                              :.|..||::...||:..|.||.|..||:...
  Rat   126 ----------------------------------IISTRSVEFPGYPPTSHYIRGYNHPSGYVCS 156

  Fly   522 EIVGKSDSCIVEWVLCL--DLKGYIPRYVLDAALTSSMTDYISNLR 565
            .:  |.:....:.|:.:  ::||.:...|::.::.|::..:..|::
  Rat   157 PL--KENPAYSKLVVFVQTEMKGKLLASVIEKSMPSNLVSFFLNVK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435
SRPBCC 247..571 CDD:301327 49/306 (16%)
Stard6NP_001007628.1 SRPBCC 1..204 CDD:417480 49/306 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335626
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.