DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and Stard3nl

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001008299.1 Gene:Stard3nl / 291182 RGDID:1308633 Length:235 Species:Rattus norvegicus


Alignment Length:249 Identity:93/249 - (37%)
Similarity:137/249 - (55%) Gaps:42/249 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PSDVRSTAQLILANARQGNSAYNMQYDMSRAHSIN---LITEDFLAGYMQDGR----MSVVRRFF 63
            |.|:.:|    |..::..:::      :...||||   |:..  :..|  :||    :|.|||.|
  Rat     5 PEDMENT----LTGSQSSHAS------LRDIHSINPGQLMAR--IESY--EGREKKGISDVRRTF 55

  Fly    64 CLFVTFDLVFVSLLWLICIVINGDNIFTAFHKQIVEYTIYKSLFDVVAVAICRFLVLIFFYAILY 128
            ||||||||:||:|||:|.:.:|| .|.....|::..|..|.|.||:..:|:.||.|||..||:..
  Rat    56 CLFVTFDLLFVTLLWIIELNVNG-GIENTLKKEVAHYDYYSSYFDIFLLAVFRFKVLILGYAVCR 119

  Fly   129 INHWSIIALSTSGSCLFLISKVFVFDWLDSK---QQVFEVILIITSFILAWGEAWFLDCRVIPQE 190
            :.||..|||:|:.:..||::||.:     ||   |..|..:|.|.||||||.|.||||.:|:|||
  Rat   120 LRHWWAIALTTAVTSAFLLAKVIL-----SKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQE 179

  Fly   191 RHAQHYFRTMTSNDRTPMEQPAILIEQERPPQSVTD--FYSLMDTARHSDEEDE 242
              |:...|.:...|.:  |:.|::      |..::|  |||..::...|:||.|
  Rat   180 --AEEENRLLLVQDAS--ERAALI------PAGLSDGQFYSPPESEAGSEEEAE 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435 77/179 (43%)
SRPBCC 247..571 CDD:301327
Stard3nlNP_001008299.1 MENTAL 49..212 CDD:402197 77/178 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335625
Domainoid 1 1.000 123 1.000 Domainoid score I5457
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I3963
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437203at2759
OrthoFinder 1 1.000 - - FOG0001150
OrthoInspector 1 1.000 - - otm45043
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46121
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.