DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and Star

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_113746.1 Gene:Star / 25557 RGDID:3770 Length:284 Species:Rattus norvegicus


Alignment Length:418 Identity:71/418 - (16%)
Similarity:139/418 - (33%) Gaps:160/418 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LIITSFILAWGEAWFLDCRVIPQERHAQHYFRTMTSNDRTPMEQPAILIEQERPPQSVTD----- 226
            :::.:|.|..|.::          ||.:        |.:....|..:.|.||...:::.|     
  Rat     1 MLLATFKLCAGSSY----------RHMR--------NMKGLRHQAVLAIGQELNRRALGDPSPGW 47

  Fly   227 ----------FYSLMDTARHSDEEDELDDEYTQMGLDCLRKAYEIIESSD-WKVEKVNQKGDTIH 280
                      ..|.::...:||:|    ..|.|.|.:.::||..|:.:.: ||.|...:.||.:.
  Rat    48 MGQVRRRSSLLGSQLEATLYSDQE----LSYIQQGEEAMQKALGILNNQEGWKKESQQENGDEVL 108

  Fly   281 STQRDKIGKIYKLTARIKYPAKALMEDLFYRIEDCPKWNPALLESKIVRKINSYTDITYQVSVGG 345
            |.....:||:::|...:..|...|.|:|..|:|...:|||.:.|.|:::||...|.||::::...
  Rat   109 SKVVPGVGKVFRLEVLLDQPMDRLYEELVDRMEAMGEWNPNVKEIKVLKKIGKDTVITHELAAAA 173

  Fly   346 GGGMVKSRDFVNLRSCRLFYNGQICDDDETAQLSSDDGNSSLNRSCEGSVSTISDGDSNTPLLPS 410
            .|.:|..||||::|..:  ..|..|                                        
  Rat   174 AGNLVGPRDFVSVRCTK--RRGSTC---------------------------------------- 196

  Fly   411 SVSSCKATFPTSSKGAAMPFDTLGNSLGAKSLGPIVNFDEEPPPLDQDEFEDAKDKVDGEANNMT 475
                                                                             
  Rat   197 ----------------------------------------------------------------- 196

  Fly   476 KPNVPSVGKTKDRVWVTSAVSVQYAAVPPSPKYTRGQNIVSGFAFREIVGKSDSCIVEWVLCLDL 540
                           |.:.::..:..:|......|.::..:......:.|......:.|:|.:||
  Rat   197 ---------------VLAGMATHFGEMPEQSGVIRAEHGPTCMVLHPLAGSPSKTKLTWLLSIDL 246

  Fly   541 KGYIPRYVLDAALTSSMTDYISNLRKHV 568
            ||::|:.:::..|:.:..::.|:|||.:
  Rat   247 KGWLPKTIINQVLSQTQIEFASHLRKRL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435 12/79 (15%)
SRPBCC 247..571 CDD:301327 56/323 (17%)
StarNP_113746.1 START_STARD1-like 69..277 CDD:176914 58/332 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166335623
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437203at2759
OrthoFinder 1 1.000 - - FOG0001150
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.710

Return to query results.
Submit another query.