DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and Stard6

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001276577.1 Gene:Stard6 / 170461 MGIID:2156774 Length:233 Species:Mus musculus


Alignment Length:310 Identity:50/310 - (16%)
Similarity:95/310 - (30%) Gaps:126/310 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 SDWKVEKVNQKGDTIHSTQRDKIGKIYKLTARIKYPAKALMEDLFYRIEDCPKWNPALLESKIVR 329
            |.||:.|.::|......|.|...|.:|::...|...| |.:.|..::.:....|:.:|....::.
Mouse    22 SGWKLIKSSKKVTVSSKTSRIFHGNLYRVEGIIPESA-AHLSDFLFKHDHRVSWDKSLKGFNVIH 85

  Fly   330 KINSYTDITYQVSVGGGGGMVKSRDFVNLRSCRLFYNGQICDDDETAQLSSDDGNSSLNRSCEGS 394
            ||:|.|.|.:.::.....|.:..|||::|...:.:                           |.:
Mouse    86 KIDSDTLICHTITQSFAMGSISPRDFIDLVHIKHY---------------------------ERN 123

  Fly   395 VSTISDGDSNTPLLPSSVSSCKATFPTSSKGAAMPFDTLGNSLGAKSLGPIVNFDEEPPPLDQDE 459
            |..||                                                            
Mouse   124 VDIIS------------------------------------------------------------ 128

  Fly   460 FEDAKDKVDGEANNMTKPNVPSVGKTKDRVWVTSAVSVQYAAVPPSPKYTRGQNIVSGFAFREIV 524
                                     ||         ||.:....|:..|.||.|..||:....: 
Mouse   129 -------------------------TK---------SVDFPGYAPTSTYIRGFNHPSGYVCSPL- 158

  Fly   525 GKSDSCIVEWVLCL--DLKGYIPRYVLDAALTSSMTDYISNLRKHVNELR 572
             |.:....:.|:.:  ::||.:|..|::.::.|::..::.|::..|...|
Mouse   159 -KENPAYSKLVIFVQTEMKGKLPASVIEKSMPSNLVSFLLNVKDGVKTYR 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435
SRPBCC 247..571 CDD:301327 49/307 (16%)
Stard6NP_001276577.1 SRPBCC 1..204 CDD:301327 48/305 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..233
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831952
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.