DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and Stard5

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_075866.2 Gene:Stard5 / 170460 MGIID:2156765 Length:213 Species:Mus musculus


Alignment Length:275 Identity:59/275 - (21%)
Similarity:91/275 - (33%) Gaps:87/275 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 PKWNPALLESK-IVRKINSYTDITYQVSVGGGGGMVKSRDFVNLRSCR----------------- 362
            |.|  |..||: :..|:..|                 .||....:.||                 
Mouse     3 PSW--ATQESEAVAEKVLRY-----------------RRDASGWKKCREGNGVSISWRPSEEFPG 48

  Fly   363 LFYNGQ--ICDDDETAQLSSDDGNSSLNRSCEGSVSTISDGDSNTPLLPSSVSSCKATFPTSSKG 425
            ..|.|:  :|...|..........|.|....:.:||:.....|.|.:|      |.:.  ||:..
Mouse    49 NLYRGEGILCGTPEEVWDCIKPVASGLREKWDDNVSSFEIVQSITDML------CVSR--TSTPS 105

  Fly   426 AAMPFDTLGNSLGAKSLGPIVNFDEEPPPLDQDEFEDAKDKVDGEANNMTKPNVPSVGKTKDRVW 490
            |||           |.:.|                   :|.||          :..|.|.:|...
Mouse   106 AAM-----------KLISP-------------------RDFVD----------LVLVKKYEDGTI 130

  Fly   491 VTSAVSVQYAAVPPSPKYTRGQNIVSGFAFREIVGKSDSCIVEWVLCLDLKGYIPRYVLDAALTS 555
            .::|..|::...||.|.:.||.|...|.....:.|..:...:......||.||:|:.|:|:....
Mouse   131 SSNATHVEHPLCPPKPGFVRGFNHPCGCFCEPLPGDPNKTNLVTFFQTDLSGYLPQSVVDSFFPR 195

  Fly   556 SMTDYISNLRKHVNE 570
            ||.::..||:|.|.:
Mouse   196 SMAEFYPNLQKAVRK 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435
SRPBCC 247..571 CDD:301327 59/275 (21%)
Stard5NP_075866.2 SRPBCC 6..211 CDD:301327 57/270 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831950
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.