DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and STARD6

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001381308.1 Gene:STARD6 / 147323 HGNCID:18066 Length:231 Species:Homo sapiens


Alignment Length:344 Identity:57/344 - (16%)
Similarity:105/344 - (30%) Gaps:157/344 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 AYEII----ESSDWKVEKVN----------QKGDTIHSTQRDKI-GKIYKLTARI-KYPAKALME 306
            |.|::    ::|.|||.|.:          :|..|:.|....|. |.:|::...| :.|||  :.
Human    11 AQEVLGYNRDTSGWKVVKTSLIICGFLFPFEKKITVSSKASRKFHGNLYRVEGIIPESPAK--LS 73

  Fly   307 DLFYRIEDCPKWNPALLESKIVRKINSYTDITYQVSVGGGGGMVKSRDFVNLRSCRLFYNGQICD 371
            |..|:..|...|:.:|....:|.:|:|.|.|.:.::.....|.:..|||::|...:.:       
Human    74 DFLYQTGDRITWDKSLQVYNMVHRIDSDTFICHTITQSFAVGSISPRDFIDLVYIKRY------- 131

  Fly   372 DDETAQLSSDDGNSSLNRSCEGSVSTISDGDSNTPLLPSSVSSCKATFPTSSKGAAMPFDTLGNS 436
                                ||:::.|                       |||            
Human   132 --------------------EGNMNII-----------------------SSK------------ 141

  Fly   437 LGAKSLGPIVNFDEEPPPLDQDEFEDAKDKVDGEANNMTKPNVPSVGKTKDRVWVTSAVSVQYAA 501
                                                                       ||.:..
Human   142 -----------------------------------------------------------SVDFPE 147

  Fly   502 VPPSPKYTRGQNIVSGF---------AFREIVGKSDSCIVEWVLCLDLKGYIPRYVLDAALTSSM 557
            .|||..|.||.|...||         |:.::|         ..:..:::|.:...:::..:.|::
Human   148 YPPSSNYIRGYNHPCGFVCSPMEENPAYSKLV---------MFVQTEMRGKLSPSIIEKTMPSNL 203

  Fly   558 TDYISNLRKHVNELRQKGR 576
            .::|.|.:..:...|...|
Human   204 VNFILNAKDGIKAHRTPSR 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435
SRPBCC 247..571 CDD:301327 55/337 (16%)
STARD6NP_001381308.1 START_STARD6-like 1..215 CDD:176913 55/335 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3845
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.