DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Start1 and stard3nl

DIOPT Version :9

Sequence 1:NP_001246495.1 Gene:Start1 / 37927 FlyBaseID:FBgn0035028 Length:583 Species:Drosophila melanogaster
Sequence 2:NP_001123730.1 Gene:stard3nl / 100170475 XenbaseID:XB-GENE-1007507 Length:234 Species:Xenopus tropicalis


Alignment Length:230 Identity:82/230 - (35%)
Similarity:126/230 - (54%) Gaps:20/230 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 NSAYNMQYDMSRAHSIN---LITE-DFLAGYMQDGRMSVVRRFFCLFVTFDLVFVSLLWLICIVI 84
            ||..:....:...||||   |::. :.|.|..:.| :|.|||.||||.|||.:||:|||:|.:.:
 Frog    13 NSLLSSHSSVHEVHSINNSELVSRLESLEGSGKKG-ISDVRRTFCLFATFDFLFVTLLWIIELNV 76

  Fly    85 NGDNIFTAFHKQIVEYTIYKSLFDVVAVAICRFLVLIFFYAILYINHWSIIALSTSGSCLFLISK 149
            :| :|..|..|:::.|..|.|.||:..::..||.:||..|||..:.||..:|::|:.:|.||:.|
 Frog    77 HG-SILDALQKEVLNYDYYYSFFDIFVLSFFRFNLLIVAYAICKLRHWWAVAVTTATTCAFLLVK 140

  Fly   150 VFVFDWLDSKQQVFEVILIITSFILAWGEAWFLDCRVIPQERHAQH---YFRTMTSNDRTPMEQP 211
            |.:.....:  ..|..:|.|.||||||.||||||.:|:|||...:.   ..|:::.....|.:.|
 Frog   141 VILSKLFST--GAFGYVLPIMSFILAWIEAWFLDFKVLPQEAEEEKRLLMIRSVSERATVPPQGP 203

  Fly   212 AILIEQERPPQSVTDFYSLMDTARHSDEEDELDDE 246
            ....:...||:|:|.         ..||.:|:.|:
 Frog   204 LSEGQFYSPPESLTG---------SEDETEEIQDD 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Start1NP_001246495.1 MENTAL 57..232 CDD:287435 68/177 (38%)
SRPBCC 247..571 CDD:301327 82/230 (36%)
stard3nlNP_001123730.1 MENTAL 49..215 CDD:402197 66/168 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 121 1.000 Domainoid score I5638
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1437203at2759
OrthoFinder 1 1.000 - - FOG0001150
OrthoInspector 1 1.000 - - otm48103
Panther 1 1.100 - - O PTHR46121
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3785
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.