DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3511 and CPR1

DIOPT Version :9

Sequence 1:NP_001286847.1 Gene:CG3511 / 37926 FlyBaseID:FBgn0035027 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_010439.1 Gene:CPR1 / 851733 SGDID:S000002562 Length:162 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:71/128 - (55%)
Similarity:82/128 - (64%) Gaps:9/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   491 GDIHMRLFFKEVPKTVENF---CVHAKNGYYNGHIFHRVIKGFMVQTGDPT-GTGTGGKSIWGSD 551
            |.:..:|:...||||.|||   |...|...|.|..|||||..||:|.||.| |.|||||||:|..
Yeast    16 GRVVFKLYNDIVPKTAENFRALCTGEKGFGYAGSPFHRVIPDFMLQGGDFTAGNGTGGKSIYGGK 80

  Fly   552 FKDEFVPSLK--HDRPYTVSMANAGPNTNGSQFFITVLPTPWLDNKHTVFGRVYRGMEVVLNI 612
            |.||   :.|  ||||..:|||||||||||||||||.:|.||||.||.|||.|..|.::|..:
Yeast    81 FPDE---NFKKHHDRPGLLSMANAGPNTNGSQFFITTVPCPWLDGKHVVFGEVVDGYDIVKKV 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3511NP_001286847.1 WD40 <75..>312 CDD:225201
WD40 <79..300 CDD:295369
WD40 repeat 85..122 CDD:293791
WD40 repeat 128..176 CDD:293791
WD40 repeat 181..210 CDD:293791
WD40 repeat 218..268 CDD:293791
WD40 repeat 275..311 CDD:293791
cyclophilin_WD40 485..633 CDD:238908 71/128 (55%)
CPR1NP_010439.1 cyclophilin_ABH_like 2..160 CDD:238907 71/128 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343462
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.