DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3511 and PPIL1

DIOPT Version :10

Sequence 1:NP_611935.1 Gene:CG3511 / 37926 FlyBaseID:FBgn0035027 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_057143.1 Gene:PPIL1 / 51645 HGNCID:9260 Length:166 Species:Homo sapiens


Alignment Length:89 Identity:25/89 - (28%)
Similarity:40/89 - (44%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 AHLDGALDRFASLFTEPLMLRDSVCRERDAVESEFQTNKNRFTPAREQLI--ASLGNDHHPISL- 219
            |.|.|.||....|    |..|..|....||.|:.....:||.....|:|:  |..|....|:.: 
Human   355 AALHGQLDCLKLL----LRGRAPVGAVNDAGETALDIARNRQHKECEELLEQAQAGTLAFPLHMD 415

  Fly   220 FSWGNLKTLKNNI-SDDELYKELH 242
            :.||:  ::::.. |::|..:|.|
Human   416 YHWGH--SMEHGFDSEEEEEEEKH 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3511NP_611935.1 WD40 repeat 85..122 CDD:293791
WD40 <94..310 CDD:441893 25/89 (28%)
WD40 repeat 128..176 CDD:293791 6/17 (35%)
WD40 repeat 181..210 CDD:293791 9/30 (30%)
WD40 repeat 218..268 CDD:293791 6/27 (22%)
WD40 repeat 275..311 CDD:293791
cyclophilin_WD40 485..633 CDD:238908
PPIL1NP_057143.1 cyclophilin_SpCYP2_like 15..161 CDD:238903
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.