DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3511 and ppil2

DIOPT Version :9

Sequence 1:NP_001286847.1 Gene:CG3511 / 37926 FlyBaseID:FBgn0035027 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_957285.2 Gene:ppil2 / 393966 ZFINID:ZDB-GENE-040426-1096 Length:524 Species:Danio rerio


Alignment Length:149 Identity:84/149 - (56%)
Similarity:106/149 - (71%) Gaps:0/149 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 VVLHTTKGDIHMRLFFKEVPKTVENFCVHAKNGYYNGHIFHRVIKGFMVQTGDPTGTGTGGKSIW 548
            |.|||.|||:::.|...:|||..|||....|.|||:|.:|||.|:.||:|.||||||||||:|.|
Zfish   282 VRLHTNKGDLNVELHCDKVPKAGENFIKLCKKGYYDGTVFHRSIRNFMIQGGDPTGTGTGGESFW 346

  Fly   549 GSDFKDEFVPSLKHDRPYTVSMANAGPNTNGSQFFITVLPTPWLDNKHTVFGRVYRGMEVVLNIC 613
            |..|||||.|:|.|.....:||||:|||||.||||||.....:||.||:|||||..|:|.:..:.
Zfish   347 GKPFKDEFRPNLSHTGRGILSMANSGPNTNKSQFFITFRSCAYLDRKHSVFGRVVGGLETLSAME 411

  Fly   614 NSKANPKTDKPYDDIKIIS 632
            |.:::||||||..:|||:|
Zfish   412 NVESDPKTDKPKSEIKILS 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3511NP_001286847.1 WD40 <75..>312 CDD:225201
WD40 <79..300 CDD:295369
WD40 repeat 85..122 CDD:293791
WD40 repeat 128..176 CDD:293791
WD40 repeat 181..210 CDD:293791
WD40 repeat 218..268 CDD:293791
WD40 repeat 275..311 CDD:293791
cyclophilin_WD40 485..633 CDD:238908 83/148 (56%)
ppil2NP_957285.2 Ubox 42..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 84/149 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.