DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3511 and Cypl

DIOPT Version :9

Sequence 1:NP_001286847.1 Gene:CG3511 / 37926 FlyBaseID:FBgn0035027 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_523874.1 Gene:Cypl / 38069 FlyBaseID:FBgn0035141 Length:176 Species:Drosophila melanogaster


Alignment Length:148 Identity:80/148 - (54%)
Similarity:102/148 - (68%) Gaps:1/148 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   484 VVLHTTKGDIHMRLFFKEVPKTVENFCVHAKNGYYNGHIFHRVIKGFMVQTGDPTGTGTGGKSIW 548
            |.|.|:.|:|.:.|::|..|.|..||...::.||||..:|||:|:.||:|.|||||||.||.||:
  Fly    23 VTLETSMGEITVELYWKHAPNTCRNFAELSRRGYYNNVVFHRIIRDFMIQGGDPTGTGRGGASIY 87

  Fly   549 GSDFKDEFVPSLKHDRPYTVSMANAGPNTNGSQFFITVLPTPWLDNKHTVFGRVYRGMEVVLNIC 613
            ||:|.||....|:|.....:||||:||:|||||||||:.||.|||.|||:|||||.|||||..| 
  Fly    88 GSEFADELHGDLRHTGAGILSMANSGPDTNGSQFFITLAPTQWLDGKHTIFGRVYTGMEVVKRI- 151

  Fly   614 NSKANPKTDKPYDDIKII 631
            ......|.|:|.|.::||
  Fly   152 GMVETDKNDRPVDPLRII 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3511NP_001286847.1 WD40 <75..>312 CDD:225201
WD40 <79..300 CDD:295369
WD40 repeat 85..122 CDD:293791
WD40 repeat 128..176 CDD:293791
WD40 repeat 181..210 CDD:293791
WD40 repeat 218..268 CDD:293791
WD40 repeat 275..311 CDD:293791
cyclophilin_WD40 485..633 CDD:238908 79/147 (54%)
CyplNP_523874.1 cyclophilin 24..170 CDD:294131 79/147 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447187
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45625
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.