DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3511 and CG7747

DIOPT Version :9

Sequence 1:NP_001286847.1 Gene:CG3511 / 37926 FlyBaseID:FBgn0035027 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_611113.1 Gene:CG7747 / 36820 FlyBaseID:FBgn0034109 Length:517 Species:Drosophila melanogaster


Alignment Length:391 Identity:114/391 - (29%)
Similarity:185/391 - (47%) Gaps:70/391 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 DRKVRVFQFNT-GKLIRVFDEALSTYTQMQQTKHALPNMEFGRRMAAERD----LEKTAQNATLN 352
            |.:..||::.. .|.::.|  .::..|..:....:|..:.|.|....|..    .:..::|:.: 
  Fly    58 DLQGNVFEYEAILKFLKTF--KVNPITGQKMDSKSLVKLNFHRNANDEYHCPALFKPFSKNSHI- 119

  Fly   353 ILFDSTGNFLLYPTMLGIKVINVVTNRCVTILGKT-------------DNIRPLQVALFQGRIKR 404
            :...:|||...:.   .|..:|:.|.....::..|             ..:....::.|. .||:
  Fly   120 VAVATTGNVYCWE---AIDQLNIKTKNWKDLVDDTPFQRKDIITIQDPQKLEKYDISTFY-HIKK 180

  Fly   405 QKAAIT-MEQEASENPALQNI--LNDPTAFCTAYKKSRFYLYSRRLPSDLQDVDRDIFNEKPSKE 466
            ....:| .||:..:|||...|  :|..|      |::     ..:|..|.|..:.:....|.:.:
  Fly   181 NLRVLTEEEQQERKNPASGRIKTMNLET------KET-----LEQLQQDYQPAEEEASTSKRTAD 234

  Fly   467 DIIA-----------------VP----EASVV-------QRIYEN--VVLHTTKGDIHMRLFFKE 501
            ...|                 ||    ||:::       :|:.:.  |.|:|..|.:::.||..:
  Fly   235 KFNAAHYSTGAVAASFTSTAMVPVSQIEAAIIDDDLVKYERVKKKGYVRLNTNLGPLNLELFCDQ 299

  Fly   502 VPKTVENFCVHAKNGYYNGHIFHRVIKGFMVQTGDPTGTGTGGKSIWGSDFKDEFVPSLKHDRPY 566
            .|:..:||..|..|||||..:|||.|:.|:||.|||||:|:||:||||..|:|||.|:|.|....
  Fly   300 TPRACDNFIKHCANGYYNNVMFHRSIRNFIVQGGDPTGSGSGGESIWGKKFEDEFKPNLTHTGRG 364

  Fly   567 TVSMANAGPNTNGSQFFITVLPTPWLDNKHTVFGRVYRGMEVVLNICNSKANPKTDKPYDDIKII 631
            .:||||:||||||||||||......||.|||:||::..|::.:..:.|.:.:.| |:|.:||.|.
  Fly   365 VLSMANSGPNTNGSQFFITYRSCKHLDGKHTIFGKLVGGLDTLQKMENIEVDNK-DRPIEDIIIE 428

  Fly   632 S 632
            |
  Fly   429 S 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3511NP_001286847.1 WD40 <75..>312 CDD:225201 5/19 (26%)
WD40 <79..300 CDD:295369 2/6 (33%)
WD40 repeat 85..122 CDD:293791
WD40 repeat 128..176 CDD:293791
WD40 repeat 181..210 CDD:293791
WD40 repeat 218..268 CDD:293791
WD40 repeat 275..311 CDD:293791 4/18 (22%)
cyclophilin_WD40 485..633 CDD:238908 72/148 (49%)
CG7747NP_611113.1 RING 25..238 CDD:302633 35/197 (18%)
cyclophilin_RING 281..439 CDD:238904 73/150 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447186
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45625
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.