DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3511 and Ppil3

DIOPT Version :9

Sequence 1:NP_001286847.1 Gene:CG3511 / 37926 FlyBaseID:FBgn0035027 Length:637 Species:Drosophila melanogaster
Sequence 2:NP_783638.1 Gene:Ppil3 / 301432 RGDID:631415 Length:161 Species:Rattus norvegicus


Alignment Length:154 Identity:86/154 - (55%)
Similarity:103/154 - (66%) Gaps:2/154 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   483 NVVLHTTKGDIHMRLFFKEVPKTVENFCVHAKNGYYNGHIFHRVIKGFMVQTGDPTGTGTGGKSI 547
            :|.|||..|||.:.:|.:..|||.|||.....:.||||.:|||.|||||||||||||||.||.||
  Rat     2 SVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSI 66

  Fly   548 WGSDFKDEFVPSLKHDRPYTVSMANAGPNTNGSQFFITVLPTPWLDNKHTVFGRVYRGMEVVLNI 612
            ||..|:||:...|||:....|||||.||||||||||||....|.||.|:||||:|..|:|.:..:
  Rat    67 WGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDEL 131

  Fly   613 CNSKANPKTDKPYDD--IKIISIH 634
            .....|.||.:|.:|  ||.|:||
  Rat   132 EKLPVNEKTYRPLNDVHIKDITIH 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3511NP_001286847.1 WD40 <75..>312 CDD:225201
WD40 <79..300 CDD:295369
WD40 repeat 85..122 CDD:293791
WD40 repeat 128..176 CDD:293791
WD40 repeat 181..210 CDD:293791
WD40 repeat 218..268 CDD:293791
WD40 repeat 275..311 CDD:293791
cyclophilin_WD40 485..633 CDD:238908 83/149 (56%)
Ppil3NP_783638.1 Cyclophilin_PPIL3_like 1..154 CDD:238909 84/151 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1392223at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.