DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and TIM50

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_015262.1 Gene:TIM50 / 856042 SGDID:S000005984 Length:476 Species:Saccharomyces cerevisiae


Alignment Length:220 Identity:52/220 - (23%)
Similarity:80/220 - (36%) Gaps:63/220 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 RKLVLLVDLDQTVIHTTNDTVPDNIKGIYHFQLYGPHSPW-----YHTRLRPGTAEFLERMSQLY 265
            |.|.|::.|:..::                      ||.|     :.|..|||...||..:||.|
Yeast   190 RPLTLVITLEDFLV----------------------HSEWSQKHGWRTAKRPGADYFLGYLSQYY 232

  Fly   266 ELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDECFNATSKTDNLKALFPNGD-SMVCIIDDR 329
            |:.:.:.....|:..||:.|||...|.|:.:......:.......:|..|  |.| |.|.|||..
Yeast   233 EIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKL--NRDLSKVIIIDTD 295

  Fly   330 EDVWNM-ASNLIQVKP-----------------YHFFQHTGDINAPPGLSKHELDGEGVDFKEIT 376
            .:.:.: ..|.|.::|                 |...|.|.|:.  |.|:..|      |.|.:.
Yeast   296 PNSYKLQPENAIPMEPWNGEADDKLVRLIPFLEYLATQQTKDVR--PILNSFE------DKKNLA 352

  Fly   377 EKHGDKDKTESSSEVKPEDTDKGDN 401
            |:...:.|       |.:|...||:
Yeast   353 EEFDHRVK-------KLKDKFYGDH 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304 38/165 (23%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
TIM50NP_015262.1 FCP1 1..354 CDD:227517 46/195 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.