DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fcp1 and AT1G43610

DIOPT Version :9

Sequence 1:NP_001286846.1 Gene:Fcp1 / 37925 FlyBaseID:FBgn0035026 Length:880 Species:Drosophila melanogaster
Sequence 2:NP_175026.1 Gene:AT1G43610 / 840945 AraportID:AT1G43610 Length:255 Species:Arabidopsis thaliana


Alignment Length:207 Identity:58/207 - (28%)
Similarity:93/207 - (44%) Gaps:48/207 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 RKLVLLVDLDQTVIHTT---------------NDTVPD----NIKGIYHFQLYGPHSPWYHTRLR 251
            :||.|::|||.|::|:.               .|:..|    |:.| |.|.:          :||
plant    51 KKLHLVLDLDHTLLHSVLVSDLSKREKYLLEETDSRQDLWRRNVDG-YEFII----------KLR 104

  Fly   252 PGTAEFLERMSQLYELHICTFGARNYAHMIAQLLDPEGKFFSHRILSRDEC-FNATSKTDNLKAL 315
            |...|||...::|:.:|:.|.|:.:||..:.:|:||:..:|..|:::|:.. ||  ...|.|.| 
plant   105 PFLHEFLLEANKLFTMHVYTMGSSSYAKQVLKLIDPDKVYFGKRVITREASPFN--KSLDLLAA- 166

  Fly   316 FPNGDSMVCIIDDREDVWNM-ASNLIQVKPYHFFQHTG---DINAPPGLSKHELDGEG-----VD 371
               ....|.|:||...||.. ..||:|:..|.:|:..|   |..|.  ..|.|....|     :.
plant   167 ---DKRRVVIVDDTVHVWPFHKRNLLQITKYIYFKVDGTKWDSYAE--AKKDESQSNGSLANVLK 226

  Fly   372 FKEITEKHGDKD 383
            |.|:..|..::|
plant   227 FLEVVHKRFEED 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fcp1NP_001286846.1 Biotinyl_lipoyl_domains 59..142 CDD:299706
FCP1_euk 202..348 CDD:131304 47/162 (29%)
COG5275 481..>658 CDD:227600
BRCT 587..665 CDD:278934
AT1G43610NP_175026.1 HAD_like 51..197 CDD:304363 47/162 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2939
eggNOG 1 0.900 - - E1_COG5190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683531at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2696
orthoMCL 1 0.900 - - OOG6_102037
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.